Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR9S7 Olfactory Receptor

Gene Symbol OR9S7
Organism Dog
Family 9
Subfamily S
Pseudo No
Location chr25:50091926-50092873 (+)
Aliases cOR9S7

Sequence information


Nucleotide sequence

ATGCCATCCCACAGTAGTGAAAACCTCTCTATGGTCTACTTTCAAGATTTTGTGCTGGAG
GGATTTGAGGGTGGCCTGGAAACCCAGGCCCTGCTCTTTGCTGTGTTCCTGGCCCTGTAC
ATGGTGACTCTGCTGGGCAACTTCCTCATGATCATCGTTATCACCCTGGATGCCCGCCTG
CACTCCCCAATGTACTTCTTCCTCAAGAACCTCTCCTTTGTGGACTTGTGCTACTCATCT
TTCATTGCTCCCAAAGCACTGGCCAACTTCTTCTCCTCATCCAAGGTCATCACCTTTGCA
GGATGTGCCACCCAGTTATTATTTTTCTCCTTGCTGGGAACAACTGAATGCTTCCTCCTG
GGTGTCATGGCCTACGACCGCTTCATGGCCATTTGTAACCCCTTGCGTTACCCCATCACC
ATGTGCCAGTCTGCCTGCACTCGCCTGGTGCTGGGCGCCTACTGTGGAGGCTGCTTCAAC
TCTGTTGTGCAGACCAGCTTCACATTCCACCTCCCATTCTGCAGCTCCAACCACATCAAC
CACTTCTTCTGTGATGTGCCTCCCTTGCTCAAACTCTCCTGTGGCGACACGGCCATCAAT
GAACTATTCTTGTTTGGCATCTGTGGGCTCATCATTGTGGGTGTAACAATTGTGATCCTC
ATCTCCTATGGCTACATCACAGTGACCATCCTGAGGATGCGCTCAGGAGCTGGGAGACGC
AAGATCTTCTCCACCTGTGGCTCCCACATGACTGCAGTGACTCTCTTTTTTGGGACTCTC
TTTGTCATGTATGCCCAGCCAGGAGCAATTGAGTCCATGGAGCAGGGCAAGGTGGTCTCT
GTCTTCTACACGCTGGTCATCCCAATGCTCAATCCCCTCATCTACAGTCTGCGAAACAAG
GATGTGAAGGAGGCCTTGTGGAGGCTGGGCCAGAAACACATGGCCTTG


Conceptual translation

MPSHSSENLSMVYFQDFVLEGFEGGLETQALLFAVFLALYMVTLLGNFLMIIVITLDARL
HSPMYFFLKNLSFVDLCYSSFIAPKALANFFSSSKVITFAGCATQLLFFSLLGTTECFLL
GVMAYDRFMAICNPLRYPITMCQSACTRLVLGAYCGGCFNSVVQTSFTFHLPFCSSNHIN
HFFCDVPPLLKLSCGDTAINELFLFGICGLIIVGVTIVILISYGYITVTILRMRSGAGRR
KIFSTCGSHMTAVTLFFGTLFVMYAQPGAIESMEQGKVVSVFYTLVIPMLNPLIYSLRNK
DVKEALWRLGQKHMAL