Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR9S8P Olfactory Receptor

Gene Symbol OR9S8P
Organism Dog
Family 9
Subfamily S
Pseudo Yes
Location chr25:50148327-50149252 (+)
Aliases cOR9S8P

Sequence information


Nucleotide sequence

ATGAAACCTCTCCATGGCCACTTTCAAGATTTTGTACTAGAGGGATTTAGGGGTGGTCTG
GAGACCCAAGCCATGCTCTTCACTGTGTTCTTGGCCTTGTACATGGTGACTATACTGGGC
AACTTCCTCATGATCATCTCTAGCACCCTGGATGCCTGCCTACACTTCCCAATGTATGTC
TTCCTCAAGAACCCCTCCTTCGTGGACTTGTGCTACTCATCTGTCATTGCCCCCAATGCA
CCGGCCAACTACTTCTCCTCATCCAAGGTCATCACCTTTACAGAATGTGCCACCCAGTTT
TTCTTTTTATCCCTGGTGGCTACCACTGAATGCTTCCTCCTGGGTGTTATGTCCTACGAC
CACTTCATGACCATTTGTAGACCCTTGAGCTACCCTAGCACCATGTGCCAGTCTGGCTGC
ACTCGCCTGGTGCTGTGCACCTACTGTGGAGGCTGCTTCAACTCTGGTGCAGAGAAGCTT
CACATTCAACCTCTCATTCTGCAGCTCCAACTGCATCAACCACGTCCTCTGTGATGTGCC
CCCTCTGTTCCATATCGCCTGTGGCAAGACGGCCATCAATGAACTTCTCTTGTTTGGCAT
CTGTGGGCTCATGATTGTGTGTGTGACATATATGGTCCTCATCTCCTATGGTTACATAAT
AGTGTCCATCCTGAGGATGGGCTCAGGAGCGGTAGATGCAAGATCTTCTCCACCTGTGGC
TCCCACATGACTGCAATGACCCTCTTTTTGGGACCGTCTTTGTAATATATACCCAGCCAG
GAGCAACTGAGTCCATGGAGCAGGGCAAGGTGGTCTCTGTCTTCTACACGCTGGTCATCC
CAGAGCTCAATCCCCTCATCTACAGTCTGCAAAACAAGGATGTGAAGGAGGCTGTGTGGA
GGCTGGGCCAGAAACACATGGCCACG


Conceptual translation

MKPLHGHFQDFVLEGFRGGLETQAMLFTVFLALYMVTILGNFLMIISSTLDACLHFPMYV
FLKNPSFVDLCYSSVIAPNAPANYFSSSKVITFTECATQFFFLSLVATTECFLLGVMSYD
HFMTICRPLSYPSTMCQSGCTRLVLCTYCGG/LQ/LVQRSFTFNLSFCSSNCINHVLC
DVPPLFHIACGKTAINELLLFGICGLMIVCVTYMVLISYGYIIVSILRMGS/SGRCKIF
STCGSHMTAMT/LFGTVFVIYTQPGATESMEQGKVVSVFYTLVIPELNPLIYSLQNKDV
KEAVWRLGQKHMAT