Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10a48 Olfactory Receptor

Gene Symbol Or10a48
Organism Mouse
Family 10
Subfamily a
Pseudo No
Location chr7:108825068-108825997 (-)
Aliases Olfr514, MOR268-1

Sequence information


Nucleotide sequence

ATGGGACAGAATGACAGCTCTGTGGTTGAGTTCATCCTGTTGGGATTTTCTCACTTCCCT
GAACTCCAAGTACACATGTTTGGAGCTTTCTTAGTTATTTATCTGGTGACTCTGACAGGA
AATGCCACCATTGTTACTGTCATCTTTCTGGACCACAGCCTACATATCCCCATGTACCTG
TTCTTGCAGAACTTGTCTGTGGTGGAAGCAAGCTTCAGCACAACTGTTATGCCTGAGATG
CTGGTGGTCCTGACTAGTGAGAAAGCAACCATTTCCTTTGGGGGTTGTTTTGCGCAGACA
TATTTCATTCTTCTCTTTGGTGGGACTGAGTGTTTTCTCCTGGGGGCAATGGCTTATGAT
CGATTTGCTGCAATCTGCTACCCTCTAACCTACCCAATGATTATGAGCAAAAGGATCTTT
GTGAAATTGGTGGTGTGCTCATGGGTCTTGGGTATCATGACAGCTACTGTGTCGGTCACA
TGGGTGTTTAGCTTCCCCTTCTGTGGTCCTAGTAAAATTAATCATATATCATGTGAAGTC
CCAGCAGTGCTGGAGCTTGCCTGTGCAGACACCTTCCTGTTTGAAGTCTATTCCTTCACA
GGCACCATTTTGCTTGTCCTGGTCCCCTTCCTGTTGATACTTTTGTCTTATACTCAAATT
CTCTTCACCGTCCTGAGGATGCCATCCACTACTGGGAGACAGAAGGCTTTTTCCACATGT
GCCTCTCATCTCACCTCTGTCACCCTCTTCTACAGCACAGCATGCATGACTTATCTACAG
CCCAAATCCAAGTACTCACCAGACACCAAGAAACTGATGTCATTGGCTTACTCTCTGCTC
ACCCCTCTGCTGAATCCACTTATCTACAGCCTGAGAAACAAGGAGATGAAAAGGGCTGTG
GTAAAATTATGCCAAATAAAAGTGGTTTTC


Conceptual translation

MGQNDSSVVEFILLGFSHFPELQVHMFGAFLVIYLVTLTGNATIVTVIFLDHSLHIPMYL
FLQNLSVVEASFSTTVMPEMLVVLTSEKATISFGGCFAQTYFILLFGGTECFLLGAMAYD
RFAAICYPLTYPMIMSKRIFVKLVVCSWVLGIMTATVSVTWVFSFPFCGPSKINHISCEV
PAVLELACADTFLFEVYSFTGTILLVLVPFLLILLSYTQILFTVLRMPSTTGRQKAFSTC
ASHLTSVTLFYSTACMTYLQPKSKYSPDTKKLMSLAYSLLTPLLNPLIYSLRNKEMKRAV
VKLCQIKVVF