Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10ag2 Olfactory Receptor

Gene Symbol Or10ag2
Organism Rat
Family 10
Subfamily ag
Pseudo No
Location chr3:75437833-75438801 (+)
Aliases Olr561, Olr561

Sequence information


Nucleotide sequence

ATGTTTTATTTACTGTTTGTAGATGAACAGAAAATTAAATCAGAAATATCAAATGCTTCT
TCTCTGATAGAATTTATTCTACTGGGTTTTTCTGATGTCCCCAATCTCCAATGGATTCTG
TTTGGGATATTTTTGATGGTATATTTGACTATTCTAATGTGCAACAGTACTATAGTGCTA
ATAACAAGAACTGACCCTGCACTGCAGACGCCTATGTATTTTTTCCTTAGCAACTTTTCT
TTTGTGGAAATATGTTATGTAACAGTCACAATCCCAAGGATGCTTGTGGACCTGTGTACT
CAAAAAGGAAATATCTCAGTACTTGCCTGTGCCACTCAAATGTGTTTTATCCTTATGCTT
GGAGGCACAGAGTGCCTCCTCCTGACAGCAATGGCCTATGACCGTTATGTGGCCATTTGT
AACCCTCTACACTATTCTCTAGTCATGAACCACAGGATCTGTACCCTGTTAGTGGCAGCC
TGCTGGATCAGTGTCATACCAGTTGTAATTGGACAAACATATCAAATTTTCTCTCTGCCT
TTTTGTGGCTCTAATAGAATTAATCATTTCATCTGTGACATCCCACCTGTACTCAAACTT
GCTTGTGGTGACACATTTGTGAACGAGATAGCAGTCTACATAGTTGCAATGGTATTTGTC
ATGGTTCCCTTTATGCTGATCATTTTTTCCTATTGCAAAATTATCTTGAGCATTCTGAAA
CTGTCATCAGCCAAAGGAAGGACCAAAGCTTTCTCCACCTGCTCCTCTCACCTGATTGTT
GTAGTCTTGTTCTATGGAACAGCTGGCATCACATACTTACAACCCAAGCCAAATCAATCA
GAAATTACAGGAAAACTGTTGTCTCTCTTCTACACCATTTTGATACCAACTCTGAATCCC
ATTATATACACTCTGAGGAACAAGGACATCATGGCAGCTCTGAGAAAACTGCTCAGTAAG
ATACTAGTG


Conceptual translation

MFYLLFVDEQKIKSEISNASSLIEFILLGFSDVPNLQWILFGIFLMVYLTILMCNSTIVL
ITRTDPALQTPMYFFLSNFSFVEICYVTVTIPRMLVDLCTQKGNISVLACATQMCFILML
GGTECLLLTAMAYDRYVAICNPLHYSLVMNHRICTLLVAACWISVIPVVIGQTYQIFSLP
FCGSNRINHFICDIPPVLKLACGDTFVNEIAVYIVAMVFVMVPFMLIIFSYCKIILSILK
LSSAKGRTKAFSTCSSHLIVVVLFYGTAGITYLQPKPNQSEITGKLLSLFYTILIPTLNP
IIYTLRNKDIMAALRKLLSKILV