Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10ag52b Olfactory Receptor

Gene Symbol Or10ag52b
Organism Rat
Family 10
Subfamily ag
Pseudo No
Location chr3:74906027-74907025 (-)
Aliases Olr545, Olr545

Sequence information


Nucleotide sequence

ATGTGGTTTGATAAGAGGAAAATGCATTCCAAATACATGAACCTACAAAGAGCAAACAAA
TTTAAAATCACAGAGACAAATATTACTATACCTATAGAATTTGTTCTCTTAGGATTTTCT
GATATTCCCAAATTGCACTGGCTTCTCTTTGGAATCTTCCTATTCATCTACACGATTATC
CTGCTGGGGAATGGCATCATCATTCTAATCACAAGGGTTGATCCCAGTCTGCAAACCCCC
ATGTATTTTTACATCAGCAATTTTTCTTTCCTAGAAATTTATTATGTTTCTGTCACTCTT
CCTAGAATGCTTATGGATCTTTTCACACTGAAAGGAAATATTTCTTTTTTGGCCTGTGCT
ACACAAATGTGCCTATTCCTTATCCTGGGGGCCACTGAATGCTTCCTGCTGGCTGTGATG
GCCTATGATCGTTATGTGGCCATTTGTAACCCTCTGCACTATCCTGTAGTCATGAGTACC
AAGCTGTGTACCCAGCTAGTGATTGCTTCCTGGGTCATTGGTATTCCCATTCAAGTGGGT
CAAACTTATCAGATTTTGTCTCTGCCCTTCTGTGATTCTAACCAAATTAATCACTTCTTC
TGTGACATACCTCCACTACTCAAATTGGCATGTGGGAACATCTTTGTGAATGAGATTGTG
GTCTTTATTTTTGCAATATTGATTGTCACTGTTCCATTCATGTTGATCCTTGCATCCTAC
AGCAGGATCATCTCAACCATCCTGAAGTTGCCATCAAACACAGGAAGGACAAAAGCCTTT
TCTACCTGTTCTTCCCACCTTATAGTTGTAATTTTATTCTTCGGATCAGGTAGTGTCACC
TATTTAAAACCTAAGTCCAGTAAGTATGAGGGAACAGACAAACTACTCTCTCTGTTTTAT
ACCGTTTTCACTCCAATGTTCAATCCCTTGATATATAGCTTCAGGAACAAAGATGTCACG
GGGGCATTGAGAAAATTATTTACCAAATTTTTAGCATTG


Conceptual translation

MWFDKRKMHSKYMNLQRANKFKITETNITIPIEFVLLGFSDIPKLHWLLFGIFLFIYTII
LLGNGIIILITRVDPSLQTPMYFYISNFSFLEIYYVSVTLPRMLMDLFTLKGNISFLACA
TQMCLFLILGATECFLLAVMAYDRYVAICNPLHYPVVMSTKLCTQLVIASWVIGIPIQVG
QTYQILSLPFCDSNQINHFFCDIPPLLKLACGNIFVNEIVVFIFAILIVTVPFMLILASY
SRIISTILKLPSNTGRTKAFSTCSSHLIVVILFFGSGSVTYLKPKSSKYEGTDKLLSLFY
TVFTPMFNPLIYSFRNKDVTGALRKLFTKFLAL