Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10ag54b Olfactory Receptor

Gene Symbol Or10ag54b
Organism Rat
Family 10
Subfamily ag
Pseudo No
Location chr3:75354222-75355256 (+)
Aliases Olr557, Olr557

Sequence information


Nucleotide sequence

ATGTGGCGTATGTACATGTTATTCAATTATCTTGAATTACATTTCTTAAAACTACAATTA
AATTGTCTTTCAGATGAAGATCTATTCAAAGAAAGATTGAATGTCTCTACACTGATGGAA
TTTATTCTTCTGGGGTTTTCTAATGTTCCTCAATTGCAGTGGGTGCTGTTTGTGATATTT
TTGTTCATGTATGTGACTATTCTGTTGTGCAACAGCATTATAATACTGTTAGCTAAAACT
GACCCTTCTCTCCAGACCCCTATGTATTATTTCCTTAGCAACTTTTCCTTTTTGGAAATC
TGTTATGTAACAGCTACTATCCCAAGAATGCTTATGGATCTATGTACTCTAAAAGGAAAC
ATTTCTGTGCTGGCCTGTGCAACACAAATGTATTTTGTCCTTATGTTGGGAGGCACAGAG
TGCCTCTTGCTAGCAGTCATGGCCTATGATCGCTATGTGGCTATTTGCCAACCTCTACAA
TATTCTCTACTCATGAAGAATACAGTGTGTTTACAGCTTGTAGCTGCCTCCTGGATCAGT
GGCATTCCAGTAGAAATTGGGCAGACCTACCAGATATTCTCTCTGCCCTTCTGTGCTTCT
AACAGAATAGATCACTTCTTCTGTGATATCCCTCCACTACTTAAGCTTGCTTGTGGTGAC
ACATTTATGAATACAGTTGCAGTCTATGTTGTTGCAGTGGGGTTTGTTATGGTTCCATTT
CTGCTAATCATTGTCTCATACATCAAGATTATCTGCAACATTATGAAACTGTCCTCAGCC
AAAGGGATGGCCAAGGCTTTTTCCACCTGCTCTTCTCACCTGATAGTTGTAGTCTTGTTC
TATGGAACAGCAAGCATTACTTACTTGCAGCCAAATCACAGTCAGTCAGAAGGAATGGGG
AAAATTCTCTCTCTTTTCTATACCATTTTGATCCCAGCTTTGAATCCCATTATATACACT
CTGAGGAACAAAGATATCATGGTGGCACTGAGGAAATTACACAATAACTTACTGACATGG
TGGGGAAACTTAAAA


Conceptual translation

MWRMYMLFNYLELHFLKLQLNCLSDEDLFKERLNVSTLMEFILLGFSNVPQLQWVLFVIF
LFMYVTILLCNSIIILLAKTDPSLQTPMYYFLSNFSFLEICYVTATIPRMLMDLCTLKGN
ISVLACATQMYFVLMLGGTECLLLAVMAYDRYVAICQPLQYSLLMKNTVCLQLVAASWIS
GIPVEIGQTYQIFSLPFCASNRIDHFFCDIPPLLKLACGDTFMNTVAVYVVAVGFVMVPF
LLIIVSYIKIICNIMKLSSAKGMAKAFSTCSSHLIVVVLFYGTASITYLQPNHSQSEGMG
KILSLFYTILIPALNPIIYTLRNKDIMVALRKLHNNLLTWWGNLK