Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10ag57 Olfactory Receptor

Gene Symbol Or10ag57
Organism Rat
Family 10
Subfamily ag
Pseudo No
Location chr3:75,412,400-75,413,400 (+)
Aliases Olr560

Sequence information


Nucleotide sequence

ATGGAATTTGTTGGATCTGCATATAAAAAGGAAATTAAAACAAAAATTTCAAATATTACA
ATTACAGAATTTGTTCTCTTGGGGTTTTCTGATGTCCCCCAACTCCAGTGGATGCTTTTT
GGGATATTTTTGTTCATGTATTTGTCTATTCTGATCAGCAACAGCATTATAATGTTAATC
ACAAGAACTGACTCAGGTCTGCAGACCCCTATGTACTTTTTCCTTAGCAACTTTTCTTTT
GTGGAAATCTGCTATGTAACAGTTACCATCCCAAGGATGCTCATGGATATTTGTACACAA
AAAGGAACAATTTCCTTATTGTCCTGTGCTGTACAGCTCTGTTTTGTCATCATGCTGGGA
GGTATGGAGTTCCTCCTCCTAACGGTCATGGCCTATGACCGTTATGTGGCCATTTGCAAT
CCTTTGCACTTTCCCCTGGTCATGAACAATAAGGTCTGTGTGCAGCTTGTGGCAGCTTGC
TGGGTCTGTATTATTCCAGTTGTGAGTGGACAAACTTACCAGATTTTCTCTTTGCCTTAT
TGTGGATCTAACAAAATTCATCACTTTTTCTGTGACATCCCCCCATTACTCAAGCTTGCT
TGTGGTGACACATTTGTGAATAATTTAGCAATCTATATTGCTTCAGTAGTGTTTATCATG
GTTCCATTTTTGTTGATCCTTGTCTCCTATGGCAAGATTATCTGCAATGTTCTAAAACTG
GCATCAACTGGAGGGAGGTCTAAAGCCTTTTCCACCTGCTCATCTCATCTGATAGTTGTG
GTTTTATTTTATGGAACAGCTACTATCACATATGTGCAACCAAAAGCATATCAGTCAGAA
AGCTTGGGAAAGTTGCTGTCTCTATTCTATACCATTTTGATTCCACTGTTGAACCCCATT
ATATATACATTGAGAAATAAGGATATAATGGTAGCACTTAGAAAATTGAAAACTAAGTTA
TCAGTATATGGGAACACT


Conceptual translation

MEFVGSAYKKEIKTKISNITITEFVLLGFSDVPQLQWMLFGIFLFMYLSILISNSIIMLI
TRTDSGLQTPMYFFLSNFSFVEICYVTVTIPRMLMDICTQKGTISLLSCAVQLCFVIMLG
GMEFLLLTVMAYDRYVAICNPLHFPLVMNNKVCVQLVAACWVCIIPVVSGQTYQIFSLPY
CGSNKIHHFFCDIPPLLKLACGDTFVNNLAIYIASVVFIMVPFLLILVSYGKIICNVLKL
ASTGGRSKAFSTCSSHLIVVVLFYGTATITYVQPKAYQSESLGKLLSLFYTILIPLLNPI
IYTLRNKDIMVALRKLKTKLSVYGNT