Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10ag58 Olfactory Receptor

Gene Symbol Or10ag58
Organism Rat
Family 10
Subfamily ag
Pseudo No
Location chr3:75465375-75466352 (+)
Aliases Olr562, Olr562

Sequence information


Nucleotide sequence

ATGCTGACTGAATCTGCTTCACAGATGAACCATCAGCCAAAACCTCAAGAAGGAAATCTA
ACGAATCTGAAGGATTTTGTTCTTCTTGGATTTTCAGATGTTCCAAATCTCCAGTGGCTT
CTATTTGGACTGTTGCTTGCCATATATTCCTTTATCATATTAGGCAATGGCACCATTGTA
CTACTCACAAAGGTAGACTCTGCTCTTCAGACCCCTATGTACTTTTTTCTTGGTAACTTT
TCCTTTTTAGAGATTTGTTTTGTATCAATTACTCTTCCCAGAATGGTCTTCAACCTTGGA
ACACAGAGAAGGACCATCTCTTTCATTGGCTGTGCTACACAAATGTGCTGCACTCTTATC
CTGGGGGCCACAGAGTGCTTCCTGCTGGCTGTAATGTCCTATGACCGCTATATTGCCATC
TGTAACCCCCTGCGCTATCCTCTAGTTATGAATCAAAGAGTATGCTCTCAATTGGTGATT
GGCTCCTGGATCAGTGGAATGCCAGTACAGATAGGGCAGACATCACAGATATTTTCTCTA
TCATTCTGTGGTTCCAACGAAATCAACCACTTCTTCTGTGACATTCCCCCAATACTTCAC
CTGGCCTGTGGGGACACCTTTATCAATGAGCTGATGGTTTTCCTAGGTGCTGCATTGTTT
TCCTTCTTTCCACTCCTGTTAATAGTCTTTTCCTATAGTAAAATCATCTCTGCAGTCCTG
AAATTGGCATCAGCCAAAAGTCGAGCCAAAGCCTTCTCTACCTGCTCATCCCATCTTGCA
GTTGTGATGTTATTTTTTGGATCAGGTATGATTACATATTTTAGATCCAATACTAGTCAT
TCAGGTGAGATAGATAAAGTGATTTCTCTTTTCTATACTGTTGTGACTCCCATGTTTAAC
CCCATGGTATACAGTCTAAGAAACAAGGATGTCACAATAGCACTGAGAAAATTCTTATGC
AAACAATTTGTAAAAATG


Conceptual translation

MLTESASQMNHQPKPQEGNLTNLKDFVLLGFSDVPNLQWLLFGLLLAIYSFIILGNGTIV
LLTKVDSALQTPMYFFLGNFSFLEICFVSITLPRMVFNLGTQRRTISFIGCATQMCCTLI
LGATECFLLAVMSYDRYIAICNPLRYPLVMNQRVCSQLVIGSWISGMPVQIGQTSQIFSL
SFCGSNEINHFFCDIPPILHLACGDTFINELMVFLGAALFSFFPLLLIVFSYSKIISAVL
KLASAKSRAKAFSTCSSHLAVVMLFFGSGMITYFRSNTSHSGEIDKVISLFYTVVTPMFN
PMVYSLRNKDVTIALRKFLCKQFVKM