Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10ag59-ps Olfactory Receptor

Gene Symbol Or10ag59-ps
Organism Rat
Family 10
Subfamily ag
Pseudo Yes
Location chr3:74544300-74545226 (-)
Aliases Olr531, Olr531

Sequence information


Nucleotide sequence

ATCAGGGCAGAGGACAATGCTACCACTGTGACACAGTTTCTCCTGCTGGGATTTTCAGAC
CTTCCCAACCTGCAAGGGTTTCTGTTTGGGATGTTTTCCATTATTTACATAATCATCTTG
ATTGGAAATAGTTTCATAATTGTCATAACTAGAATTGATCCTGCACTACAAAAGCCCATG
TATTTTTTCCTGGCAAATTTTTCTTCTCTGGAAATCTGTTATGTATCAGTCACACTTCCT
AGGATTCTGTTTAACATTGCTGCTCAAGACAGACATATTTCTGTCCTTAGGTGTGCCACA
CAAATGTGTTTCTTCCTTATACTGGGAGCCACTGAGTGTTTCCTGCTGGCTGTGATGTCC
TATGACCGCTATGTGGCCATCTGCAACCCTCTGCACTATCCTCTGGTCATGAACCCAACA
AAGTGCACTCAGCTGGCAGCAGGCTCCTGGCTGGGAGGTATCCCTGTCCAGATAGGACAA
ACCTGTCAGATATTCTCTCTACATTTTTGCAATTCTAACAAAATCAACCACTTCTTCTGT
GACATACCTCCCATTCTCAAGCTGGCCTGTGGAGACACTTCTATTAATGAGCTGTCTGTC
TATTTAGTGGCTATACTCTTTGCTGCAGTCCCTTTTATGTTGATACTTGCTTCTTACAGC
AAAATCATTGCCACCATTCTGAAGTTGCCAACAGCCACCGGACGGGCAAAAGCATTCTCA
ACATGTTCTTCCCATTTGCTTGTTGTGTTTTTGTTTTTTGGATCAGCTACTGTTACCTAC
TTGAGGCCTAAGTCCAACCATTCTCCAGGAACTGACAAATTGTTCTCTCTATTTTACACT
ATTGTGACTCCCATGTTAAATCCACTGATATACAGCCTTAGAAACAAGGAGGTGATCGCT
GCACTGAGAAAGCTGCTACCTATAAAG


Conceptual translation

IIRAEDNATTVTQFLLLGFSDLPNLQGFLFGMFSIIYIIILIGNSFIIVITRIDPALQKP
MYFFLANFSSLEICYVSVTLPRILFNIAAQDRHISVLRCATQMCFFLILGATECFLLAVM
SYDRYVAICNPLHYPLVMNPTKCTQLAAGSWLGGIPVQIGQTCQIFSLHFCNSNKINHFF
CDIPPILKLACGDTSINELSVYLVAILFAAVPFMLILASYSKIIATILKLPTATGRAKAF
STCSSHLLVVFLFFGSATVTYLRPKSNHSPGTDKLFSLFYTIVTPMLNPLIYSLRNKEVI
AALRKLLPIK