Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10ag60 Olfactory Receptor

Gene Symbol Or10ag60
Organism Mouse
Family 10
Subfamily ag
Pseudo No
Location chr2:87607390-87608331 (+)
Aliases Olfr1130, RP23-463G15.6, MOR264-4, RP23-463G15.6, MOR264-4

Sequence information


Nucleotide sequence

ATGAAATTCACAGAAATCAGGGCAGAGGATAATGCTTCCACTGTGACAGAGTTTCTCCTC
CTGGGATTTTCAGACCTTCCTAACTTACAAGGGATTTTGTTTGGGATGTTCTCCATAATT
TACTTGATCATATTGGTTGGAAATAGTTTCATAATTGTGATAACTAGAATTGATCCTGCA
CTACAGAAGCCCATGTATTTTTTCCTGGCAAATTTTTCTTCTCTGGAAATCTGTTATGTT
TCAGTCACTCTCCCTAGGATTCTGTTTAGCATTGCTACTCAAGAGAGAAAGATTTCTGTC
CTCAGCTGTGCCACCCAGTTGTGTTTCTTCCTTATGCTGGCAGCCACTGAGTGTTTCCTG
CTGGCTGTGATGTCTTATGACCGCTATGTGGCCATCTGTAACCCTCTGCACTATCCTTTG
GTCATGAACCCAACAAAGTGCACTCAGCTGGCAGCAGCCTCCTGGCTTGGAGGCATCCCA
GTCCAGATAGGACAAACCTGTCAGATATTTTCTCTACATTTCTGCAATTCTAACCAAATC
AACCACTTCTTGTGTGACATACCACCCATTCTCAAGCTGGCCTGCGGAGACACGTCAATA
AATGAGCTATCTGTCTATTTAGTGGCTATATTATTTGCTGCAGTCCCTTTTATGTTGATT
CTTGCATCTTATGGCAAAATCATTGCCACCATTCTGAAGTTGCCAACAGCCACAGGACGG
GCAAAAGCCTTCTCAACATGTTCTTCCCACTTGCTTGTGGTGTTTTTGTTTTTTGGATCA
GCTACTATTACCTACTTGAGGCCAAAGTCCACCCATTCTCCAGGAACTGACAAACTATTC
TCTCTGTTTTACAGCATTGTGACTCCCATGTTAAATCCTCTGATATACAGTCTTAGAAAC
AAGGAGGTGATTGCTGCACTGAGAAAATTGTTACGTATCAAG


Conceptual translation

MKFTEIRAEDNASTVTEFLLLGFSDLPNLQGILFGMFSIIYLIILVGNSFIIVITRIDPA
LQKPMYFFLANFSSLEICYVSVTLPRILFSIATQERKISVLSCATQLCFFLMLAATECFL
LAVMSYDRYVAICNPLHYPLVMNPTKCTQLAAASWLGGIPVQIGQTCQIFSLHFCNSNQI
NHFLCDIPPILKLACGDTSINELSVYLVAILFAAVPFMLILASYGKIIATILKLPTATGR
AKAFSTCSSHLLVVFLFFGSATITYLRPKSTHSPGTDKLFSLFYSIVTPMLNPLIYSLRN
KEVIAALRKLLRIK