Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10ak11 Olfactory Receptor

Gene Symbol Or10ak11
Organism Rat
Family 10
Subfamily ak
Pseudo No
Location chr5:137,635,000-137,636,000 (-)
Aliases LOC679803

Sequence information


Nucleotide sequence

ATGTGGATGATTCTAGGACAGAACCAAAGTTGGGTTTCAGAGTTCATCCTGCTTGGCTTC
TCCAGAGACCCCATGACCAACAGCATCCTCTTCCTTGTCTTCCTTATTGTTTACCTGAGC
TCAGTCCTGGGCAACGGGCTCATCATCATGCTGGTCTACCTGGACACACAGCTGCACACG
CCCATGTACTTCTTCCTCTGTACCCTCTCTCTGTTTGATATGAGCTATGTCACCACCACC
ATGCCCCAGATGTTGGTGCATCTTCTTGCTCACTCTCAGACCATCTCCTTTGCTGGCTGC
TGGGTGCAAATGTATGTGTTTGGGGCCCTGGGTATAACCGAGTGCACCTTCTTTGTTGTG
ATGGCTTATGACCGGTATGTGGCCATTTGCTATCCACTGCACTATACTGTCATCCTCAGC
TGGGGCCTGTGCATACGGTTGGCAGCAGGGTCTTGGATCTGTGGTTTCCTTTCCTCTCTA
TTTAATACTTTCTTCACCATGAGTCTGCCATATTGTGGGTCCAACAGGGTCAACCACTAC
TTGTGTGAAGGTCCTTCAGTGCGGAGCCTGGCTTGCATGGATACCCACGTTCTTGAGATG
GTGGACTTAATCTTAAGTGTCCTTTTGGTTGTTATTCCAATTTCCCTCATTGTGGCCTCC
TACATTCGTATTGCCAAGGCAATTCTGAAGATCAAGTCCACCCAGGGCCGCTGCAAGGCT
TTCTCTACCTGTGCCTCCCACCTGACTGTGGTTACACTTTTCTACATTCCAGCCACTTAC
ATTTACATGAAGCCAAACTCCAGCTACTCTCCTGAGCAAGACAAGCAGATCTCACTGTTT
TACAGTGCGTTTACACCCTTGCTCAACCCTGTGGTCTACAGTCTAAGAAACAAGGACATC
AAAAGGGCCTTCCTCAAGGTGATGGTTTATGGCAGGTGGACTGGTAGATTACGATGG


Conceptual translation

MWMILGQNQSWVSEFILLGFSRDPMTNSILFLVFLIVYLSSVLGNGLIIMLVYLDTQLHT
PMYFFLCTLSLFDMSYVTTTMPQMLVHLLAHSQTISFAGCWVQMYVFGALGITECTFFVV
MAYDRYVAICYPLHYTVILSWGLCIRLAAGSWICGFLSSLFNTFFTMSLPYCGSNRVNHY
LCEGPSVRSLACMDTHVLEMVDLILSVLLVVIPISLIVASYIRIAKAILKIKSTQGRCKA
FSTCASHLTVVTLFYIPATYIYMKPNSSYSPEQDKQISLFYSAFTPLLNPVVYSLRNKDI
KRAFLKVMVYGRWTGRLRW