Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10ak14 Olfactory Receptor

Gene Symbol Or10ak14
Organism Mouse
Family 10
Subfamily ak
Pseudo No
Location chr4:118753598-118754590 (-)
Aliases Olfr1338, RP23-154A15.9, MOR259-9

Sequence information


Nucleotide sequence

ATGTGTCAGATGATACATAGAATAATGGATTCTCTTACAGGCTCCACCATGTGGATGTTT
CCAAGGCAGAACCAAAGTTGGGTTTCAGAGTTCATCCTGATTGGCTTCTCCAGTGATCCC
ACAACCAACAGCATCCTCTTCATTGTCTTCCTTCTCATCTACCTGAACTCAGTCCTGGGC
AACGGACTCATCATCATGCTGGTCTGCCTGGACACACAGCTGCACACTCCTATGTACTTT
TTCCTCTGTACCCTCTCCCTGTTGGATATGAGCTATGTCACTACCACCATGCCCCAGATG
TTGGTGCATCTTCTTGCTCACTCTCAGACCATCTCCTTTGCTGGCTGCTGGCTGCAGATG
TATATGTTCAGTGCCCTGGGTATAGCTGAGAGCATCCTCTTTGTTGTGATGGCTTATGAC
CGGTATGTGGCAATTTGCTATCCACTGCGCTATACTGTCATCCTCAACTGGGGCCTGTGC
ATACGATTGGCAGCAGGGACTTGGATCTGTGGTTCCTTTTCCTCTTTGTTGCATACTTTC
TTCACCATGAGTCTGCCATATTGTGGGCCCAAAAGGGTTGACCACTATTTCTGTGAAGGT
CCTTCAGTGCGTAGTCTGGCTTGCATGGATACCCACCTCATTGAGATGGTGGACTTGGTG
TTGAGTGTTTTTGTGGTTGTTACTCCAATTTCCCTCATTGTGGCTTCCTACATTCACATT
ACCAAGGCAATTCTCAAGATCAAGTCCACCCAGGCCCGCTGTAAAGCTTTCTCTACCTGT
GCCTCCCACCTGACTGTGGTCACATTTTTCTATATTCCAGCCATTTACATCTACATTAGG
CCAAACTCCAGCTACTCCCCTGAGAGAGACAAGCAGATCTCACTCTTTTACAATGTTTTC
ACAGCCTTGCTCAACCCTGTGGTCTATAGTCTGAGAAACAAGGACATTAAGAGGGCATTT
CTCAAGGTAATGGGACTTGGTAGGATGGACTGG


Conceptual translation

MCQMIHRIMDSLTGSTMWMFPRQNQSWVSEFILIGFSSDPTTNSILFIVFLLIYLNSVLG
NGLIIMLVCLDTQLHTPMYFFLCTLSLLDMSYVTTTMPQMLVHLLAHSQTISFAGCWLQM
YMFSALGIAESILFVVMAYDRYVAICYPLRYTVILNWGLCIRLAAGTWICGSFSSLLHTF
FTMSLPYCGPKRVDHYFCEGPSVRSLACMDTHLIEMVDLVLSVFVVVTPISLIVASYIHI
TKAILKIKSTQARCKAFSTCASHLTVVTFFYIPAIYIYIRPNSSYSPERDKQISLFYNVF
TALLNPVVYSLRNKDIKRAFLKVMGLGRMDW