Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10ak7 Olfactory Receptor

Gene Symbol Or10ak7
Organism Mouse
Family 10
Subfamily ak
Pseudo No
Location chr4:118933902-118934894 (-)
Aliases Olfr1328, MGC129205, MOR259-13

Sequence information


Nucleotide sequence

ATGTGTCAGGTAACACATAGAATAATGGATTCTCTTACAGCCTCCACCATGTGGATGATT
CCAGAGCAGAACCAAAGTTGGGTTTCAGAGTTCATCCTGATTGGCTTCTCCAGTGACCCC
ACGACCAACAGCATCCTCTTCATTGTCTTCCTTCTCATTTACCTGAGCTCAGTCCTGGGC
AATGGGCTCATCATCCTGCTGGTCTGCCTGGACACACAGCTGCACACTCCCATGTACTTC
TTCCTCTGTACCCTCTCCCTGTTGGATATGAGCTATGTCACCACCACCATGCCCCAGATG
TTGGTGCATCTTCTTGCTCACTCTCAGACCATCTCCTTTGCTGGCTGCTGGCTGCAGATG
TATGTGTTTGGTGCCCTGGGTATAACTGAGTGTACTTTCTTCGTTGTCATGGCTTATGAC
CGGTATGTGGCCATATGCTATCCATTGCGCTATACTGTCATCCTTAACTGGGGCTTGTGC
ATACGGTTGGCAGCAGGGTCTTGGATCTGTGGTTTCTTTTCCTCTTTATTGCATACTTTC
TTCACCATGAGTCTGCCATACTGTGGGCCCAACAGGGTCAACCACTACTTCTGTGAAGGT
CCTTCAGTGCGTAGCTTGGCTTGCATGGATACCCACCTCATTGAGATGGTGGACTTTGTG
TTGAGTGTTTTTGTGGTTGTTATTCCAATTTCCCTCATTGTGGCCTCCTATATTCGTATT
GCCATGGCAATTCTCAAAATCAAGTCCACCCAGGGGCGCTGCAAGGCTTTCTCTACCTGT
GCCTCCCACCTGACTGTGGTCACATTCTTTTATGCTCCAGCCACTTACATCTACCTTAGG
CCCAACTCCAGCTACTCCCCTGAGCGAGACAAGCAGGTCTCACTCTTTTACAATGCCTTC
ACAGCCTTGCTCAACCCTGTGGTCTACAGTCTGAGGAACAAGGACATCAAGAGGGCATTT
CTCAAGGTGATGGGACATAGTAGGCTGGACCAG


Conceptual translation

MCQVTHRIMDSLTASTMWMIPEQNQSWVSEFILIGFSSDPTTNSILFIVFLLIYLSSVLG
NGLIILLVCLDTQLHTPMYFFLCTLSLLDMSYVTTTMPQMLVHLLAHSQTISFAGCWLQM
YVFGALGITECTFFVVMAYDRYVAICYPLRYTVILNWGLCIRLAAGSWICGFFSSLLHTF
FTMSLPYCGPNRVNHYFCEGPSVRSLACMDTHLIEMVDFVLSVFVVVIPISLIVASYIRI
AMAILKIKSTQGRCKAFSTCASHLTVVTFFYAPATYIYLRPNSSYSPERDKQVSLFYNAF
TALLNPVVYSLRNKDIKRAFLKVMGHSRLDQ