Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10ak8 Olfactory Receptor

Gene Symbol Or10ak8
Organism Mouse
Family 10
Subfamily ak
Pseudo No
Location chr4:118916527-118917519 (-)
Aliases Olfr1329, RP23-149E24.7, MOR259-2

Sequence information


Nucleotide sequence

ATGTGTCAGGTAACACATAGAATAATGGATTCTCTTACAGCCTCCACCATGTGGATGATT
CCAGGGCAGAACCAAAGTTGGGTTTCTGAGTTCATCCTGCTTGGCTTCTCCAGTGTCCCC
ACAACCAACAGCATCCTCTTCATTGTCTTCCTTCTCATCTACCTGAGCTCAGTCCTGGGC
AATGGGCTCATCATCATGCTGGTCTGCCTGGACACACAGCTGCACACTCCCATGTACTTC
TTCCTCTGTACCCTCTCCCTGTTGGATATGAGCTTTGTCACTACCACTGTGCCCCAGATG
TTGGTGCATCTTCTTGCTCACTCTCAGACCATCTCCTTTGCTGGCTGCTGGCTGCAGATG
TTTGTGTTCGGTGCCCTGGGTATGACTGAGTGCACCTTCTTTGTTGTCATGGCTTATGAT
CGGTATGTGGCTATTTGCTATCCATTGCGCTATACTGTCATCCTCAACTGGGGCCTGTGC
ATACGGTTGGCAGGAGGGACTTGGATCTCTGGTTTCTTTTCTTCTTTATTGCATACTTTC
TTTACCATGAGTCTGCCATATTGTGGGCCCAACAGGGTCAACCACTACTTCTGTGAAGGT
CCTTCAGTGCGTAGCCTGGCTTGCATGGATACTCATGTCATTGAGATGGTGGACTCTGTC
TTGATTGTCATTTTGGTTATTGTTCCAATTTCCCTTATTGTGGCCTCCTACATTCGTATT
GTCATGGCAATTCTCAAGATCAAGTCCACCCAGGGGCGCTGCAAGGCTTTCTCTACCTGT
GCCTCCCACCTGACTGTGGTTACACTCTTCTACGTCCCTGCCAGCTACATCTACCTTAGG
CCCAACTCCAGCTATTCCCCTGAGCGAGACAAGCAGGTCTCACTCTTTTACAATGTCTTC
ACAGCCTTGCTCAACCCTGTGGTCTACAGTCTGAGGAACAAGGACATCAAGAGGGCATTT
CTCAAGGTGATGGGACATGCTAGGGTAGATTCA


Conceptual translation

MCQVTHRIMDSLTASTMWMIPGQNQSWVSEFILLGFSSVPTTNSILFIVFLLIYLSSVLG
NGLIIMLVCLDTQLHTPMYFFLCTLSLLDMSFVTTTVPQMLVHLLAHSQTISFAGCWLQM
FVFGALGMTECTFFVVMAYDRYVAICYPLRYTVILNWGLCIRLAGGTWISGFFSSLLHTF
FTMSLPYCGPNRVNHYFCEGPSVRSLACMDTHVIEMVDSVLIVILVIVPISLIVASYIRI
VMAILKIKSTQGRCKAFSTCASHLTVVTLFYVPASYIYLRPNSSYSPERDKQVSLFYNVF
TALLNPVVYSLRNKDIKRAFLKVMGHARVDS