Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10al4 Olfactory Receptor

Gene Symbol Or10al4
Organism Rat
Family 10
Subfamily al
Pseudo No
Location chr20:1061729-1062691 (-)
Aliases Olr1698-ps, Olr1698-ps, SCR D-2

Sequence information


Nucleotide sequence

ATGACTGTCAACTGTTCTCTGTGGCAGGAGAATAGTTTGACTGTCAAACACTTTGCATTT
GCCAAGTTCTCTGAGGTCCCTGGAGAATGCTTCCTCCTGTTCAACCTCATCCTTCTCATG
TTCTTAGTATCAGTAACAGGAAATACTCTCATAGTCCTTGCTATTTGTACCAGTCCATCT
CTACACACCCCCATGTACTTCTTTCTGGCCAACTTGTCTCTCCTGGAGATTGGCTATACT
TGCTCTGTCATACCCAAGATGCTGCAGAGCCTTGTGAGTGAGGCCAGAGAGATCTCTCGG
GAGGGATGTGCCACACAGATGTTTTTTTTCGCATTTTTTGGTATAACTGAGTGCTGCCTA
TTGGCAGCCATGGCCTTTGACCGCTGCATGGCCATATGCTCCCCACTCCACTATGCAACC
CGAATGAGTCGTGAGGTATGTGCCCATTTGGCAATTGTTTCATGGGGAATGGGATGCATA
GTAAGTCTGGGACAAACCAATTTTATTTTCTCCTTGAACTTCTGTGGACCCTGTGAAATA
GACCACTTCTTCTGTGACCTTCCACCTCTCCTGGCACTTGCCTGTGGAGATACATCCCAA
AACGAGGCTGCCATCTTTGTGGTAGCAGTCCTCTGCATATCTAGCCCATTTTTGCTGATC
ATTTATTCTTATGTCAAAATTCTCATTGCAGTGCTTATGATGCCTTCACCTGAGGGGCGC
CATAAAGCTCTTTCCACCTGTTCGTCTCACCTACTTGTAGTCACACTTTTTTATGGCTCA
GCATGTATTACCTATTTGAGGCCCAAGTCTAGCCACTCACCAGGAATGGACAAATTCTTG
GCCCTCTTCTACACAGTAGTGACATCCATGCTGAACCCTATCATCTATAGTTTAAGGAAC
AAGGAAGTCAAGGCAGCACTGAGAAGAACTCTGGGCCTGAAAAAAATTCTGTCAATTAAT
AGG


Conceptual translation

MTVNCSLWQENSLTVKHFAFAKFSEVPGECFLLFNLILLMFLVSVTGNTLIVLAICTSPS
LHTPMYFFLANLSLLEIGYTCSVIPKMLQSLVSEAREISREGCATQMFFFAFFGITECCL
LAAMAFDRCMAICSPLHYATRMSREVCAHLAIVSWGMGCIVSLGQTNFIFSLNFCGPCEI
DHFFCDLPPLLALACGDTSQNEAAIFVVAVLCISSPFLLIIYSYVKILIAVLMMPSPEGR
HKALSTCSSHLLVVTLFYGSACITYLRPKSSHSPGMDKFLALFYTVVTSMLNPIIYSLRN
KEVKAALRRTLGLKKILSINR