Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10bb2-ps Olfactory Receptor

Gene Symbol Or10bb2-ps
Organism Rat
Family 10
Subfamily bb
Pseudo Yes
Location chr1:95481150-95481989 (-)
Aliases Olr1802-ps

Sequence information


Nucleotide sequence

ACTTTGACTCTGATGTAACTGAGCCTCTAAAATACTAAAAAATCAATATCTCTCATATGC
AAGAATCCTACTAATTGCTTACTGCTCTGTCATCCAGGAGATGAGTGTCAAGTGTGTCAA
TTGCTCTTTGTGGCAGGAAAAGGGCTTGTCTGTCAAATGCTTTGCAATTGCCAAGAACTG
TGAGGTCCCTGGAGAATGCTTCCTCTGTTCACCCTAATTCTGCTCTCATAGCCTTTGCTA
TCTGCACCCGTCCATCTCTACACACCCCCATGTACTTCTTTCTGGGGAACTTATGTATCC
TGGAAATTGGTCACACTGGCTCTGTCACACCCAAGATATGGAGAGCCGTGTGAGTGAGAT
CTGAGGAATCTCTCAGGAGGGATGTGCCCCACAGATGTTGTTCTTCACACTTTTTGGTAT
AACTGAGTGCTTCCTATTGGCAGTCATGGCCTTTGGACACTGTATGGCCCCGCTTCACTA
TGCAACCCAAATGAGTCGTGAGGTATGCGCCCATTTGGCAATTGTTTCATGGGGAATAGG
TTGCCTTGTAGGGTTGGGCCAAAACTACTTGAGACCCAAATCTAACCACCCACAAGGTGT
TGAAAAATTCTTGGTCATCTTCCATACCACAGTGACATCCATGCTGAACCCCATCATCTA
TAGCTTAAGGAACCAAGAAGTCAAGGCAGCACTGAGAATGACTCTGGGTCAGAAGAAAGT
TCTGATAATAAATAGCTAATTAAGGATCCCAAAGTGCTCTTTCACAAGGTGCAAAGTCTG
TGAAAGAACGAAAAAAAAAACCACTGTGCTCCTTCTTGCTGTCTTGAAACAAACTTTAAG


Conceptual translation

LIAFAICTRPSLHTPMYFFLGNLCILEIGHTGSVTPKIWRAV*VRSE/ISQEGCAPQML
FFTLFGITECFLLAVMAFGHCMAPLHYATQMSREVCAHLAIVSWGIGCLVGLGQNYLRPK
SNHPQGVEKFLVIFHTTVTSMLNPIIYSLRNQEVKAALRMTLGQKKVLIINS