Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10q12 Olfactory Receptor

Gene Symbol Or10q12
Organism Mouse
Family 10
Subfamily q
Pseudo No
Location chr19:13768197-13769300 (+)
Aliases Olfr1495, MOR266-9, MOR266-9

Sequence information


Nucleotide sequence

ATGCGAGGCTTTTATTATGAATGTATTTTCACCATTGTACTTGAAAACAGAATACTAAAT
AGGCAATCCCTAATCAAAACTCAGAATTGGCCTCTCTACCCTTCATATAAGCCATCAATC
ATTGGCTTTTTTTTTTTTTCAGAAGACATGGTGGATAGAAACCCTTTCTTCAACAAATCT
GGTCCACCAGAGTTCGTGTTCCGTGTCTTAACCAATGTTCCGGAATTTCAAGCAATCCTC
TTCACCCTCTTCTTCCTTCTCTACTTGATGATCCTCTGTGGCAATACCACCATTATCTGG
GTGGTGTGCAACCACAGCTCCCTGCACACTCCCATGTACTTCTTCCTGGGCAGTCTGTCA
TTTGTGGAAATCTGCTACATCACAGATGTGGTGCCCTTGATTCTTTCCAACATCTTTGGA
GACCAAAAACCCATATCACTGGCTGGTTGTGGGACACAAATGTTCTTTTTCTCTGTCTTT
GGCTGCACGGATTGTTTTCTCTTGACGGTCATGGCTTATGACAGATATGTGGCCATCTGT
CACCCACTACACTACAACCTCATCATGACCCAGAAACTGTGTGTCCAGATGGTAATAGGC
TCTTTGAGCTTGGCACTTCTTCTCTCCTTGGAGCTTACTGCCTTTACTTTCACATTGCCG
TTCTGTAGACACCGCCTTGAAATCAACCACTTCCTCTGTGATGTGGCTCCTATTATGCGC
CTGGCCTGTGCTGACATCCATGTGAACCAGGCAGTCCTCTATGTAGTTAGTATCCTAGTT
CTGACAGTCCCATTCCTGCTCATTTTCATCTCTTATGTGTTCATTGCTTCTACCATTCTA
CGCATGCATTCTGCAGAGGGACGCCAGAGGGCATTCTCCACCTGTTCCTCCCATCTCACT
GTGGTTTTGCTACAATATGGCTGTTGTAGCCTAGTGTACCTGAGACCCCGCTCCAGCACC
TCAGAGGATGAGGATCGCCAAATTGCCCTGGTTTATATCTTTGGTACTCCATTACTAAAC
CCTCTGATTTACACCCTCAGGAATAAAGATATCAAAGATGCTTTGAGGAACTCTTTCTTC
CATGTACCAGCTTCTGACACTAGT


Conceptual translation

MRGFYYECIFTIVLENRILNRQSLIKTQNWPLYPSYKPSIIGFFFFSEDMVDRNPFFNKS
GPPEFVFRVLTNVPEFQAILFTLFFLLYLMILCGNTTIIWVVCNHSSLHTPMYFFLGSLS
FVEICYITDVVPLILSNIFGDQKPISLAGCGTQMFFFSVFGCTDCFLLTVMAYDRYVAIC
HPLHYNLIMTQKLCVQMVIGSLSLALLLSLELTAFTFTLPFCRHRLEINHFLCDVAPIMR
LACADIHVNQAVLYVVSILVLTVPFLLIFISYVFIASTILRMHSAEGRQRAFSTCSSHLT
VVLLQYGCCSLVYLRPRSSTSEDEDRQIALVYIFGTPLLNPLIYTLRNKDIKDALRNSFF
HVPASDTS