Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10q12 Olfactory Receptor

Gene Symbol Or10q12
Organism Rat
Family 10
Subfamily q
Pseudo No
Location chr1:230,604,000-230,605,000 (+)
Aliases Olr375

Sequence information


Nucleotide sequence

ATGGTGGATGAAAAGTCTTTCTTCAATAAATCTGGTCCACCAGTGTTCACATTCCGTGTC
TTAACTAATGTTCCTGAATTCCAGGCAATTCTCTTCATTCTCTTCCTCCTTCTCTATTTG
ATGATCCTCTGTGGCAACACCACCATCATCTGGGTAGTGTCCAAGTACAGCTTCCTGCAC
ATGCCCATGTATTTCTTCCTGGGCAGTCTGTCATTTGTGGAAATTTGCTACATCACAGAT
GTGGTGCCCTTGATGCTTTCTAACATCTTTGGAGCGCAGAAGCCCATATCACTGGCTAGT
TGTGGGACACAAATGTTCTTTTTTTCTGTTTTTGGCTGCACTGATTGTTTTCTCTTGACA
GTCATGGCTTATGACAGATATGTGGCTATCTGCCATCCACTACACTACAACCTTATCATG
ACCCAGAAGCTGTGTATCAAGTTGGTGATAGGTTCTTTGAGCTTGGCACTTTTTCTCTCT
TTGCCCCTTACTGCCTTTACCTTCACATTGCCATTCTGCAGATACCACCTGGAAATTAAC
CACTTCCTTTGCGATGTGGCTCCTATCATGCGCCTGGCCTGTGCTGACATCCACGTGAAC
CAGGCAGTCCTCTATGTAGTTAGCATCCTAGTTCTGACAGTACCATTCCTGCTAATTTGC
ATCTCTTATGTGTTCATCGCTTCTACCATTCTGCGCATGCATTCTGCAAAGGGTCGCCAG
AGGGCATTCTCCACCTGTTCCTCCCACCTCACTGTGGTTTTGCTACAATATGGCTGCTGT
AGCCTAGTGTACCTGAGGCCCCGCTCCAGCACCTCAGAGGATGAGGACCGCCAAATTGCC
CTGGTTTACATCTTTGGTACTCCGTTACTCAACCCTCTTATTTATACCCTTAGGAATAAA
GATATCAAAGATGCTCTGAGGAACTCTTTCTTCCGTACATCAGCTTCTGATACTAGT


Conceptual translation

MVDEKSFFNKSGPPVFTFRVLTNVPEFQAILFILFLLLYLMILCGNTTIIWVVSKYSFLH
MPMYFFLGSLSFVEICYITDVVPLMLSNIFGAQKPISLASCGTQMFFFSVFGCTDCFLLT
VMAYDRYVAICHPLHYNLIMTQKLCIKLVIGSLSLALFLSLPLTAFTFTLPFCRYHLEIN
HFLCDVAPIMRLACADIHVNQAVLYVVSILVLTVPFLLICISYVFIASTILRMHSAKGRQ
RAFSTCSSHLTVVLLQYGCCSLVYLRPRSSTSEDEDRQIALVYIFGTPLLNPLIYTLRNK
DIKDALRNSFFRTSASDTS