Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10q3 Olfactory Receptor

Gene Symbol Or10q3
Organism Mouse
Family 10
Subfamily q
Pseudo No
Location chr19:11870186-11871214 (-)
Aliases Olfr1419, MOR266-10, MOR266-10

Sequence information


Nucleotide sequence

ATGGAGGAGGAAAATCAGACAGGAGTGGTATATTTCCACTTCCGCCCCTTTTCAACCAAC
TCTACAGTGGCTTCCCTAGTGTTTGTGGGCTTCTTGCTGCTGTATCTAGGAAGTCTCATT
GGAAACCTCACCATTGGGCTCACAGTCTGGCAGGATCACTCCCTCCATACCCCGATGTAC
TTCTTCCTTTTTGTGTTGGCCACATTAGAGCTTGGCTATTCCACCAACATTGCTCCACTG
ACTCTAGCTAGCATTCTCTCCATGGGGAAGATGCTTATCTCTCTGCCCAGCTGTGGGGCC
CAGATGTTCTTCTTCATCCTCCTTGGAGGATCTGACTGTGTCCTGCTGGCCATCATGGCC
TATGACAGGTATGTGGCCATCTGTCATCCATTGCATTACAGCCTCATTATGAGTTGGCAG
CTCTGTGGGCAGATGGCTTTAGGTTCTCTGGGGCTGGGTTTCCTTTTGTCACTGCCTTTG
ACCATTCTGATCTGCCACCTCCCATTCTGTGGCCACAATGAAATCTACCACTTCTTCTGC
GACATGCCTGCAGTCATGCGCCTGGCCTGTACAGATACCCATATACACCAGGCAGCTCTC
TTTGCCATCAGCGTGGCTGCAGTAGCCATTCCTTTTCTCCTTATCTGTCTCTCCTATGGT
TGCATTGTGGCTACCATCCTGAGGATGACGTCAGCAGAGGGGAAACGCCGGGCTTTCTCC
ACCTGCTCTTCACACCTCCTCGTGGTTGTCCTGCAGTATGGATGTTGCACCCTCATCTAC
CTTCGCCCTAGCTCCAGCTACTCCCCGGAAGAAGGCCGGGCAGTATCTGTTGTCTATACC
TTCTTCTCCCCATTGCTGAATCCCTTAATCTATAGTTTAAGGAACCAAGAGGTGACTGAT
GCAGTAAAAAGACTTTTGACAAGAATGTTCTGGTTCAGAAAGCCAGAAAGATTCCTTCCT
GGGGGAAATTATTCACTGAACAAGGGAGAACACAGTATGATGGAAAAGAAACTCAAAATC
AATAGGCCA


Conceptual translation

MEEENQTGVVYFHFRPFSTNSTVASLVFVGFLLLYLGSLIGNLTIGLTVWQDHSLHTPMY
FFLFVLATLELGYSTNIAPLTLASILSMGKMLISLPSCGAQMFFFILLGGSDCVLLAIMA
YDRYVAICHPLHYSLIMSWQLCGQMALGSLGLGFLLSLPLTILICHLPFCGHNEIYHFFC
DMPAVMRLACTDTHIHQAALFAISVAAVAIPFLLICLSYGCIVATILRMTSAEGKRRAFS
TCSSHLLVVVLQYGCCTLIYLRPSSSYSPEEGRAVSVVYTFFSPLLNPLIYSLRNQEVTD
AVKRLLTRMFWFRKPERFLPGGNYSLNKGEHSMMEKKLKINRP