Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10v1 Olfactory Receptor

Gene Symbol Or10v1
Organism Mouse
Family 10
Subfamily v
Pseudo No
Location chr19:11896023-11896949 (+)
Aliases Olfr1420, MOR266-4, MOR266-4

Sequence information


Nucleotide sequence

ATGGAAATAATAAATAAAACTGCCAAGGTACAATTCTTCTTTCGTCCATTCTCACCTGAC
CCTGGGGTGCAGATGGTGATTTTTGTGACCTTCTTGGTGATGTACCTGACCAGCCTCAGT
GGAAATGCCACAATTGCTGTGATTGTCCATATTAACCACTCACTCCACACCCCCATGTAC
TTTTTTCTAGCTAATTTGGCAGTTCTGGAAATCTTCTATACATCATCCATTGCACCACTG
GCCTTGGCAAACCTTCTTTCTATGGGGAAAACTCCTGTTTCCATCACTGGTTGTGGTACC
CAGATGTTTTTCTTTGTTTTCTTGGGTGGAGCTGACTGTGTCCTGCTTGCAGTCATGGCT
TACGACCGGTTTGTTGCGATCTGCTACCCTCTGAGATACACACTCATCATGAGTTGGTCC
TTGTGTGTAGAGATGATGGTGGGGTCCCTGGTGCTGGGATTCCTGCTGTCACTGCCCCTA
ACTATTTTAATCTTCCATCTGCCATTCTGCCACAACAATGAAATCTATCACTTCTACTGT
GACATGCCTGCAGTCATACGCCTGGCTTGTGGAGACACGCATGTTCATAGGACTGCCCTG
TATATCATCAGCTTCATTGTCCTAAGCATCCCCCTAACTCTGATCTCTATCTCCTATGTC
TTCATCATCACAGCGATTTTACGGATCCGGTCTGCTGAAGGGCGCCATCGAGCCTTCTCT
ACCTGCTCCTCTCACATCGTAGTGGTCCTCCTACAGTATGGCTGCACCAGTTTTATATAT
TTATCCCCCAGTTCCAGCTACTCTCCTGAGATGGGCAGAATGGTGTCTGTGGTCTACACT
TTTATCACCCCCATTTTAAACCCTTTGATCTATAGTATGAGGAACAAGGAACTAAAAGAT
GCTCTGAGGAAGGCATTGAGAAAGTTC


Conceptual translation

MEIINKTAKVQFFFRPFSPDPGVQMVIFVTFLVMYLTSLSGNATIAVIVHINHSLHTPMY
FFLANLAVLEIFYTSSIAPLALANLLSMGKTPVSITGCGTQMFFFVFLGGADCVLLAVMA
YDRFVAICYPLRYTLIMSWSLCVEMMVGSLVLGFLLSLPLTILIFHLPFCHNNEIYHFYC
DMPAVIRLACGDTHVHRTALYIISFIVLSIPLTLISISYVFIITAILRIRSAEGRHRAFS
TCSSHIVVVLLQYGCTSFIYLSPSSSYSPEMGRMVSVVYTFITPILNPLIYSMRNKELKD
ALRKALRKF