Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10v1 Olfactory Receptor

Gene Symbol Or10v1
Organism Rat
Family 10
Subfamily v
Pseudo No
Location chr1:228317412-228318338 (+)
Aliases Olr319, Olr319

Sequence information


Nucleotide sequence

ATGGAAACAATAAATAAAACTGCCAAGATAAATTTCTTCTTTCGCCCATTCTCATCTGAC
CCTGGGGTGCAGATGGTGATTTTTGTGACCTTCTTAGTGATGTACCTGACCAGCCTCAGC
GGTAATGCTACAATTGCTGTGATTGTCCACATTAACCATGCACTGCACACTCCCATGTAC
TTTTTTCTAGCTAACTTGGCAGTTCTGGAAATCTTCTATACATCATCCATTGCACCACTG
GCCTTGGCAAACCTTCTTTCTATGGGTAAAACCCCTGTTTCCATCACTGGTTGTGGTACC
CAGATGTTTTTCTTTGTTTTCTTGGGTGGGGCTGACTGTGTCCTGCTTGCAGTCATGGCT
TACGACCGGTTTGTTGCAATCTGCTACCCTCTGAGATACACACTCATCATGAGCTGGTCC
TTGTGTGTAGAGATGATGGTGGGGTCCCTGGTGCTGGGATGCCTGCTGTCACTGCCCCTA
ACTATTTTAATCTTCCATCTGCCATTCTGTCACAACAATGAGATCTACCACTTCTACTGT
GACATGCCTGCAGTCATACGCCTGGCTTGTGGAGACACGCACGTTCATAGGACAGCCCTG
TACATCATCAGCTTCATTGTCCTAAGCATCCCCCTAACTCTGATTTCTATCTCCTATGTC
TTCATCATCACGGCCATTTTACGGATCCGGTCTGCTGAAGGGCGCCATCGAGCCTTCTCT
ACCTGCTCCTCTCACATTGTAGTGGTCCTCCTACAATATGGCTGCACCAGTTTTATATAT
TTATCCCCCAGTTCCAGCTACTCTCCTGAGATGGGCAGAATGGTGTCTGTGGTCTACACT
TTCATCACCCCCATCTTAAACCCTTTGATCTATAGTATGAGGAACAAGGAACTAAAAGAT
GCTCTGAGGAAGGCATTGAAAAAGTTC


Conceptual translation

METINKTAKINFFFRPFSSDPGVQMVIFVTFLVMYLTSLSGNATIAVIVHINHALHTPMY
FFLANLAVLEIFYTSSIAPLALANLLSMGKTPVSITGCGTQMFFFVFLGGADCVLLAVMA
YDRFVAICYPLRYTLIMSWSLCVEMMVGSLVLGCLLSLPLTILIFHLPFCHNNEIYHFYC
DMPAVIRLACGDTHVHRTALYIISFIVLSIPLTLISISYVFIITAILRIRSAEGRHRAFS
TCSSHIVVVLLQYGCTSFIYLSPSSSYSPEMGRMVSVVYTFITPILNPLIYSMRNKELKD
ALRKALKKF