Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10v5 Olfactory Receptor

Gene Symbol Or10v5
Organism Mouse
Family 10
Subfamily v
Pseudo No
Location chr19:11828080-11829024 (-)
Aliases Olfr1417, MOR266-2, MOR266-2

Sequence information


Nucleotide sequence

ATGGAAGAAGGAAATCAGACTGGGATGGTCCTCTTCCACTTCCGCCCCTTCTCCAAACTC
CCTGAGGTGCAGATGCTGATCTTTGTGCTTTTCCTCATGATGTACCTGGTCAGCATCGGG
GGAAACATGTCCATCGTCCTCACCATCTGGACCAATCGGTGTCTCCACACCCCTATGTAC
TTCTTCCTGGCCAACCTGGCTAGCCTGGAGATCTTCTATTCTTCTACCATAGCCCCCCTG
ACTCTGGCCAGCATCCTGTCCACAGAGAGGACTGTGGTTTCCTTGGCAGGCTGTGGTGCC
CAGATGTTCTTCTTCATCTTCCTGGGCAGTGCTGACTGTATTCTGCTGGCTGTCATGGCC
TATGACCGGTTTGTGGCCATCTGTCACCCTCTGCGCTATACCCTCATCATGAGCTGGCAC
TTGTGTGTCCAGCTGGCCCTGGGGTCCCTGTTGCTGGGTTTCATCTTGGCCATGCAGTTG
ACTGTGCTCATCTTCCGACTGCCTTTCTGTAGCAGTAAGGAAATCAGCTTGTTCTACTGT
GATGTCCTCCCTGTCATGAGACTGGCATGTGCAGACACCCATGTCCATGAGGCCACTCTG
TTTGTGGTCAGTGTCATCGTCCTCACCATCCCTTTCCTCCTCATCACTCTCTCCTATGTC
TTCATTGTGGATGCCATCCTGAAGATCCGCTCAGCTGAGGGGAGGCACAAAGCCTTCTCT
ACCTGTTCTTCCCACCTGACCGTTGTCCTCCTGCAGTATGGATGTGGAAGCCTCATCTAC
TTGTGTCCCAGCTCCAGCTACTCTCCTGAGAGGGGCCAGGTAGTATCTGTGGTTTACACC
TTCATCACTCCTGTGCTGAATCCTTTGATCTACAGCATGAGGAACAGAGAACTCAAGGAT
GCTTTGAGGAAGGTGGTGATAAGCTTCCTCCTGCTTGAAAAACAA


Conceptual translation

MEEGNQTGMVLFHFRPFSKLPEVQMLIFVLFLMMYLVSIGGNMSIVLTIWTNRCLHTPMY
FFLANLASLEIFYSSTIAPLTLASILSTERTVVSLAGCGAQMFFFIFLGSADCILLAVMA
YDRFVAICHPLRYTLIMSWHLCVQLALGSLLLGFILAMQLTVLIFRLPFCSSKEISLFYC
DVLPVMRLACADTHVHEATLFVVSVIVLTIPFLLITLSYVFIVDAILKIRSAEGRHKAFS
TCSSHLTVVLLQYGCGSLIYLCPSSSYSPERGQVVSVVYTFITPVLNPLIYSMRNRELKD
ALRKVVISFLLLEKQ