Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10v9 Olfactory Receptor

Gene Symbol Or10v9
Organism Mouse
Family 10
Subfamily v
Pseudo No
Location chr19:11854998-11856032 (-)
Aliases Olfr1418, MOR266-5, MOR266-5

Sequence information


Nucleotide sequence

ATGACAAGTGTCCTCCAGGTAGGTTCAATCTATCCTCAGGGCCATCACCTGTGCCAGTGG
CAGACCCAACGCATTAAGTTCATGGAGGAAGGAAATCAGACTGGGATGGTCCTCTTCCAC
TTCCGCCCCTTCTCCAAACTCCCTGAGGTGCAGATGCTGATCTTTGTGCTTTTCCTCATG
ATGTACCTGGTCAGCATCGGGGGAAACATGTCCATCGTCCTCACCATCTGGACCAATCGG
TGTCTCCACACCCCTATGTACTTCTTCCTGGCCAACCTGGCTAGCCTGGAGATCTTCTAT
TCTTCTACCATAGCCCCCCTGACTCTGGCCAGCATCCTGTCCACAGAGAGGACTGTGGTT
TCCTTGGCAGGCTGTGGTGCCCAGATGTTCTTCTTCATCTTCCTGGGCAGTGCTGACTGT
ATTCTGCTGGCTGTCATGGCCTATGACCGGTTTGTGGCCATCTGTCACCCTCTGCGATAT
ACCCTCATCATGAGCTGGCACTTGTGTGTCCAGTTGGCCCTGGGGTCCCTGTTGCTGGGT
TTCATCTTGGCCATGCAGTTGACTGTGCTCATCTTCCAATTGCCTTTCTGTAGCAGTAAG
GAAATCAGCTTGTTCTACTGTGATGTCCTCCCTGTCATGAGACTGGCATGTGCAGACACC
CATGTCCATGAGGCCACTCTGTTTGTAGTCAGTGTCATCGTCCTCACCATCCCTTTCCTC
CTCATCACTCTCTCCTATGTCTTCATTGTGGATGCCATCCTGAAGATCCGCTCAGCTGAG
GGGAGGCACAAAGCCTTCTCTACCTGTTCTTCCCACCTGACGGTTGTCCTCCTGCAGTAT
GGATGCACAAGTCTCATCTACTTGTGTCCCAGCTCCAGCTACTCTCCTGAGAGGGGCCAG
GTAGTATCTGTGGTTTACACCTTCATCACCCCTGTGCTGAATCCTTTGATCTACAGCATG
AGGAACAGAGAACTCAAGGATGCTTTGAGGAGAGTGATAATGAAATTGGTTCTGATCCAA
ACACAAGAAGCACTC


Conceptual translation

MTSVLQVGSIYPQGHHLCQWQTQRIKFMEEGNQTGMVLFHFRPFSKLPEVQMLIFVLFLM
MYLVSIGGNMSIVLTIWTNRCLHTPMYFFLANLASLEIFYSSTIAPLTLASILSTERTVV
SLAGCGAQMFFFIFLGSADCILLAVMAYDRFVAICHPLRYTLIMSWHLCVQLALGSLLLG
FILAMQLTVLIFQLPFCSSKEISLFYCDVLPVMRLACADTHVHEATLFVVSVIVLTIPFL
LITLSYVFIVDAILKIRSAEGRHKAFSTCSSHLTVVLLQYGCTSLIYLCPSSSYSPERGQ
VVSVVYTFITPVLNPLIYSMRNRELKDALRRVIMKLVLIQTQEAL