Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10v9b Olfactory Receptor

Gene Symbol Or10v9b
Organism Rat
Family 10
Subfamily v
Pseudo No
Location chr1:228262245-228263198 (-)
Aliases Olr318, Olr318

Sequence information


Nucleotide sequence

ATGGAGAAAGGAAATCAGACTGGAATGGTCCTCTTCCACTTCCGCCCCTTTTCCAAACTC
CCCGAGGTGCAGATGCTGATCTTTGTGCTTTTCCTCATGATGTACCTGATCAGCATTGGA
GGAAACATGTCCATTGTCCTCACCATCTGGATCAATCGGTGTCTCCACACCCCTATGTAC
TTCTTCCTGGCCAACCTGGCTAGCCTGGAGATCTTCTATTCCTCTACCATAGCCCCCCTG
ACTCTGGCCAGCATCCTGTCCACAGAGAGGACTGTGGTCTCCCTGGTAGGCTGTGGTGCC
CAGATGTTCTTCTTCATCTTCCTGGGCAGCGCCGATTGTATTCTGCTGGCTGTCATGGCC
TATGACCGGTTTGTGGCCATCTGTCACCCTCTGCGCTACACCCTCATCATGAGCTGGCAC
CTGTGTGTCCAGCTGGCCCTAGGGTCCCTGTTGTTGGGTTTCATCTTGGCCATGCAGTTG
ACTGTGCTCATCTTCCAACTACCTTTCTGTAGCAGTAAGGAAATCAGCTTGTTCTACTGT
GATGTCCTCCCTGTCATGAGACTCGCATGTGCAGACACCCATGTCCATGAAGCTACTCTG
TTTGTGGTCAGTGTCATCGTCCTTACCATCCCTTTTCTCCTCATCACTCTCTCCTATGTC
TTCATTGTGAATGCCATCGTGAAGATCCGCTCAGCTGAGGGGAGGCACAAAGCCTTCTCT
ACCTGTTCTTCTCACCTGACGGTTGTCCTCCTGCAGTACGGTTGTACAAGTCTCATCTAC
TTGTGTCCCAGCTCCAGCTACTCTCCTGAGCGAGGCCAGGTAGTATCTGTGGTTTACACC
TTCATCACTCCTATGTTGAATCCTTTGATCTACAGCATGAGGAACAGAGAACTCAAGGAT
GCCTTGAGGAGAGTGATAATGAAATTGGTTTTGATCCAAACACAAGAAACACTC


Conceptual translation

MEKGNQTGMVLFHFRPFSKLPEVQMLIFVLFLMMYLISIGGNMSIVLTIWINRCLHTPMY
FFLANLASLEIFYSSTIAPLTLASILSTERTVVSLVGCGAQMFFFIFLGSADCILLAVMA
YDRFVAICHPLRYTLIMSWHLCVQLALGSLLLGFILAMQLTVLIFQLPFCSSKEISLFYC
DVLPVMRLACADTHVHEATLFVVSVIVLTIPFLLITLSYVFIVNAIVKIRSAEGRHKAFS
TCSSHLTVVLLQYGCTSLIYLCPSSSYSPERGQVVSVVYTFITPMLNPLIYSMRNRELKD
ALRRVIMKLVLIQTQETL