Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10w1 Olfactory Receptor

Gene Symbol Or10w1
Organism Rat
Family 10
Subfamily w
Pseudo No
Location chr1:230521416-230522432 (+)
Aliases Olr372, Olr372

Sequence information


Nucleotide sequence

ATGATTAAACTGACAGATATTTGTTTTTGTTTTTGTTTTTGCATCCAAAAGAGAATGCCT
GTGGACTCAATGACTTGGGAGAACCACACATTGTTCATGGAGTTTGTGTTCCTTGCCTAT
CCAAAACACCCAGTACTACGCATGCTCTGCTTCTTTGGAGTCAGCCTTGCTTATGGATTA
ATAATCTCTGGGAATATCCTTATTGTGGTCTCCATAAAGACTGAAATCCGTCTACATACA
CCCATGTACTATTTCTTGGGCAGCCTCTCAGGGATAGAACTGTGCTACACTGCAGTGGTG
GTACCACACATTTTGGCCAACACCTTTCAGTCTGAGAAAACTATTACTCTACTGAGCTGT
GCCACTCAGATGGTTTTCCTCATTGGGCTTGGTAGTGCTGATTGCTTCCTCCTGGCTATC
ATGGCCTATGACAGATATTTTGCCATCTGTCATCCGTTGCAGTACCCTCTCATCATGACT
GTAACTCTTTGTGTTCGCTTGGTTGTGGCTTCTGTGGTCATTGGTTTATTCCTGTCCTTA
CAGCTTGTGGTCTTCATCTTCTGTCTGCCATTCTGTCAGGATAGAGGAATAGAGCACTTC
TTTTGTGATGCTCCACCAATGATGCGTCTTGTGTGTGCCACAAGTCATATCCATGAGCTC
TCTGTGCTAGTGGCAGCCACAATAGCCATTGCCGTGCCTTTCTTTTTCATTGCCACTACC
TATGCTTTGATTGTGGCTGCTGTGCTTAAACTCCACTCAGCAGCTGGCCGTCACAGGGCC
TTCAACACATGTTCTTCTCACCTCACTGTGGTGTTGTTGCAGTATGGCTGCTGTGCATTC
ATGTACCTGCGCCCAGTCTCCAGCTACCATCCCAAGCAAGATAAGTTCATCTCCCTGGTA
TACATACTGGGGACGCCATTCCTCAATCCCCTCATCTACACTTTGAGGAACAATGAGATG
AAAGGGGCCATAGCTAAAGTTCTAACCAGAAAGTATCTCTCCTGGAAAATTATAGGA


Conceptual translation

MIKLTDICFCFCFCIQKRMPVDSMTWENHTLFMEFVFLAYPKHPVLRMLCFFGVSLAYGL
IISGNILIVVSIKTEIRLHTPMYYFLGSLSGIELCYTAVVVPHILANTFQSEKTITLLSC
ATQMVFLIGLGSADCFLLAIMAYDRYFAICHPLQYPLIMTVTLCVRLVVASVVIGLFLSL
QLVVFIFCLPFCQDRGIEHFFCDAPPMMRLVCATSHIHELSVLVAATIAIAVPFFFIATT
YALIVAAVLKLHSAAGRHRAFNTCSSHLTVVLLQYGCCAFMYLRPVSSYHPKQDKFISLV
YILGTPFLNPLIYTLRNNEMKGAIAKVLTRKYLSWKIIG