Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or10w3 Olfactory Receptor

Gene Symbol Or10w3
Organism Mouse
Family 10
Subfamily w
Pseudo No
Location chr19:13726224-13727210 (+)
Aliases Olfr1493

Sequence information


Nucleotide sequence

ATGATTTCTTTTAATATAAGGAGAATATTTGTGGTTTCAATGACCTGGGAGAACCACTCA
GTGTTGATGGAGTTTGTGTTCCTTGCCTATCCCAATCGCCTAGAACTTCGTATGTTCTGC
TTCCTTGGAATAAGCCTGGCTTATGCATTGATCATCTCTGGGAATATCCTCATTATGGTC
TCCATCCAGACAGAAACACGTCTACATTCACCCATGTACTATTTCCTGGGCAGCCTATCA
GGAATAGAGCTATGTTACACTGCAGTGGTGGTGCCACATATCCTGGCAAACACCCTGAAG
TCAGAGAAAAACATTACTCTGCTGAGCTGTGCCACTCAGATGGTCTTCTTTATTGGACTT
GGTAGTGCTGACTGCTTCCTCCTGGCTTCCATGGCCTATGACAGATATGTTGCCATCTGT
CATCCTTTACAGTACCCTCTCATCATGACTGTAACACTTTGTGTTCGCTTGGTTTTGGCT
TCGGTGGTCATTGGCTTGGTCTTGTCCTTACAGCTTGTGGTCTTCATCTTCTGTCTACCA
TTCTGTCAGGACAGAGGAATAGAACATTTCTTTTGTGATGTTCCTCCAGTGATGCGTCTC
GTGTGTGCCACAAGTCATATCCATGAGCTCTCTGTGCTAGTGGCCGCCGCATTAGCCATT
GCTGTACCTTTCTTTTTCATTGCGACTACATATGCCTTGATAGTGGCTGCTGTGCTCAAA
CTCCACTCAGCAGCTGGTCGTCACAGGGCCTTCAACACCTGTTCTTCCCACCTCACTGTG
GTATTGTTGCAGTATGGCTGCTGTGCCTTCATGTACCTGCGCCCGAACTCTAGCTACCAC
CCCAAGAAAGATCAGTTCATCTCCCTGGTGTACACACTGGGAACCCCATTCCTCAACCCT
CTCATCTACACTCTGAGGAACAATGAAATGAAAGGGGCCATAGAGAAGGTTCTTACCAGA
AATTATTTCTCCCAGAAAAATATACAA


Conceptual translation

MISFNIRRIFVVSMTWENHSVLMEFVFLAYPNRLELRMFCFLGISLAYALIISGNILIMV
SIQTETRLHSPMYYFLGSLSGIELCYTAVVVPHILANTLKSEKNITLLSCATQMVFFIGL
GSADCFLLASMAYDRYVAICHPLQYPLIMTVTLCVRLVLASVVIGLVLSLQLVVFIFCLP
FCQDRGIEHFFCDVPPVMRLVCATSHIHELSVLVAAALAIAVPFFFIATTYALIVAAVLK
LHSAAGRHRAFNTCSSHLTVVLLQYGCCAFMYLRPNSSYHPKKDQFISLVYTLGTPFLNP
LIYTLRNNEMKGAIEKVLTRNYFSQKNIQ