Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or10w3 Olfactory Receptor

Gene Symbol Or10w3
Organism Rat
Family 10
Subfamily w
Pseudo No
Location chr1:230553486-230554433 (+)
Aliases Olr373, Olr373

Sequence information


Nucleotide sequence

ATGACTTGGGAGAACCACTCAGTACTGATGGAATTTGTGTTCCTTGCCTATCCTAATCAC
CTAGAACTACGTATGCTCTGCTTCCTTGGAGTAAGCCTGGCTTATGCATTGATCATCTCT
GGGAATATTCTCATTGTGGTATCCATCCAGACAGAAACCCGTCTACATGCACCCATGTAC
TATTTCTTGGGAAGCTTATCAGGTATAGAACTATGTTACACTGCAGTGGTGGTACCTCAC
ATCCTGACAAACACCCTGCAGTCAGAGAAGACCATTACTCTGCTGAGCTGTGCCACCCAG
ATGGTCCTTTTCATTGGACTTGGCAGTGCTGATTGCTTCCTCTTAGCTTCCATGGCCTAT
GACAGATATGTTGCCATCTGTCATCCCTTGCAGTACCCTCTTTTCATGACTGTAACTCTT
TGTGTTCGCTTGGTTGTGGCTTCTGTGATCATTGGCATGGTCTTGTCCTTACAGCTTGTG
ATCTTCATCTTTTGTCTACCATTCTGTCAGGACAGAGGAATAGAACATTTTTTTTGTGAT
GTGCCACCAGTGATGCAACTTGTGTGTGCCACGAGTCATATCTATGAGCTTTCTGTGCTA
GTGGCTGCTGCCCTAGCCATAGTTGTGCCTTTCTTTTTCATTGCCACCACCTATGCCTTG
ATAGGAGCTGCTGTGCTCAAACTCCACTCAGCAACTGGCCGTCACAGGGCCTTTAACACC
TGTTCCTCCCACCTCACTGTGGTGTTGTTGCAGTATGGCTGTTGTGCCTTCATGTACCTG
CGCCCCAAGTCTAGTTTCCATCCCAAACAAGATCAATTCATCTCCCTGGTATACACACTG
GGAACCCCATTCCTCAATCCTCTTATCTACACTCTGAGAAACAATGAAATGAAAGGTGCC
ATAGAGAAAGTACTTACCAGAAATTATTTCTCCCAGAAAATTGTACAA


Conceptual translation

MTWENHSVLMEFVFLAYPNHLELRMLCFLGVSLAYALIISGNILIVVSIQTETRLHAPMY
YFLGSLSGIELCYTAVVVPHILTNTLQSEKTITLLSCATQMVLFIGLGSADCFLLASMAY
DRYVAICHPLQYPLFMTVTLCVRLVVASVIIGMVLSLQLVIFIFCLPFCQDRGIEHFFCD
VPPVMQLVCATSHIYELSVLVAAALAIVVPFFFIATTYALIGAAVLKLHSATGRHRAFNT
CSSHLTVVLLQYGCCAFMYLRPKSSFHPKQDQFISLVYTLGTPFLNPLIYTLRNNEMKGA
IEKVLTRNYFSQKIVQ