Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or12e1 Olfactory Receptor

Gene Symbol Or12e1
Organism Mouse
Family 12
Subfamily e
Pseudo No
Location chr2:87191689-87192642 (+)
Aliases Olfr1112, RP23-116P4.8, MOR264-6, RP23-116P4.8, MOR264-6

Sequence information


Nucleotide sequence

ATGGATGGATCCACCCTACAAAGTCCCCAACAGAACCACTCCACATTTGTAGCATTCATC
TTACTTGGCTTTTCTGATGTTCCCAACTTGCAAGAATTTCTTTTTGGGTTGTTTTTGATG
GTCTATCTAATTATTCTGATGGGCAATAGCCTCATTATCATAATTATAAGAGCTGACCCT
TCCCTGCAAACTCCCATGTACTTTTTCCTTGGAAATTTTTCTTTCTTAGAAATGTGTTAT
GTGTCAGTCACTCTGCCAAGGTTATTAACAGATCTCTACAGACAAGACAGAATCATTTCT
TTCATGGCTTGTGCTACACAAATGTATTTTTTTCTTATCTTTGGGGCCACTGAGTGCTTT
ATTCTGACGGCTATGGCTTATGACAGATATGTTGCTATTTGTAACCCATTGCTCTATCCT
CTCATTATGAACAATAGTCTCTGTATACAACTGGCAGCTGGCTGTTGGATAAGTGGAGTT
CCTGTTCATATAGGGTTCACATACTGGATCTTCTCTCTACCATTTTGTGGATCAAATCAG
CTGAATCACTTTTTCTGTGACATACCTCCAGTCCTGACCCTAGCTTGTGGGGACACTTTT
ATGATAGAGATGCTAATTTATGTGATTGCCCTTTTAGTTGTCACCATTCCTTTTATGCTG
ATCCTTGCATCTTATGTGAAAATAATCTCAAGCATTCTGAAGCTTCCATCTGCAACTGGG
AGAGCCAAGGCCTTCTCTACATGTTCTTCCCACCTTATAGTTGTAGCTTTATTCTTTGGA
TCAGGTATCATTACATACTTGAGACCAAAGTCCAGCCACTCAGCAGGAGTAGACAAATTC
CTTTCTCTTTTCTATACTGTTGTGACTCCACTGTTCAACCCCATGATATACTGTTTAAGA
AACAAAGATGTTATGATTGCATTGAAAAAAATTTTTCTGAGATGCTTCATGTTA


Conceptual translation

MDGSTLQSPQQNHSTFVAFILLGFSDVPNLQEFLFGLFLMVYLIILMGNSLIIIIIRADP
SLQTPMYFFLGNFSFLEMCYVSVTLPRLLTDLYRQDRIISFMACATQMYFFLIFGATECF
ILTAMAYDRYVAICNPLLYPLIMNNSLCIQLAAGCWISGVPVHIGFTYWIFSLPFCGSNQ
LNHFFCDIPPVLTLACGDTFMIEMLIYVIALLVVTIPFMLILASYVKIISSILKLPSATG
RAKAFSTCSSHLIVVALFFGSGIITYLRPKSSHSAGVDKFLSLFYTVVTPLFNPMIYCLR
NKDVMIALKKIFLRCFML