Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or12e1 Olfactory Receptor

Gene Symbol Or12e1
Organism Rat
Family 12
Subfamily e
Pseudo No
Location chr3:75265525-75266472 (+)
Aliases Olr554, Olr554

Sequence information


Nucleotide sequence

ATGGATCCACTCTACAGTCTTCAACAGAACCATTCCACATTAGTAGAATTCATCTTACTT
GGCTTTTCTGATGTTCCCAACTTGCAAGAATTTCTTTTTTGGGTGTTTTTGATAATCTAT
GTAATTATCCTGATGGGCAATAGCCTTATTATCATTATTACAAAGGTTGACCTTTCGCTA
CGAACTCCCATGTACTTTTTTCTTAGTAATTTTTCTTTCTTGGAAATGTGTTATGTGTCA
GTAACTCTTCCCAGGTTATTAACAGATCTCTACAGACAACACAGAATTATTTCTTTTATG
GCTTGTGCTACACAAATGTATTTCTTTCTTGTCTTTGGGGCCACTGAGTGCTTTATTCTG
ACTGCTATGGCTTATGACAGATATGTTGCTATTTGCAACCCACTGCTATACCCTCTCATC
ATGAACAATAGTCTCTGTATACAACTGGCAGCTGGATGTTGGATAAGTGGAGTTCCTGTT
CATATAGGGTTCACATATTGGATCTTCTCTCTACCATTTTGTGGGTCAAATCAGTTGAAT
CACTTTTTCTGTGACATACCTCCAGTCCTGACCCTAGCTTGTGGGGACACTTTTATGATA
GAGATGCTGATTTATGTGATTGCCCTTTTAGTGGTTACCATTCCTTTTATGCTGATTCTT
GGATCTTATGTGAAAATAATCTCAAACATTCTGAAGCTGCCATCAGCAATTGGGAGAGCC
AAGGCCTTCTCTACATGTTCTTCCCACGTTATTGTTGTAGCGTTATTCTTTGGATCAGGT
ATCATTACATACTTGAGACCAAAGTCCAGCCACTCAGCAGGATTAGACAAATTCCTTTCT
CTTTTCTATACTGTTGTTACTCCAATGTTTAACCCCATGATATATTGTTTGAGAAACAAA
GATGTTATGATTGCATTGAAAAAGTTTCTTCTGAGATGGTTAATGTTA


Conceptual translation

MDPLYSLQQNHSTLVEFILLGFSDVPNLQEFLFWVFLIIYVIILMGNSLIIIITKVDLSL
RTPMYFFLSNFSFLEMCYVSVTLPRLLTDLYRQHRIISFMACATQMYFFLVFGATECFIL
TAMAYDRYVAICNPLLYPLIMNNSLCIQLAAGCWISGVPVHIGFTYWIFSLPFCGSNQLN
HFFCDIPPVLTLACGDTFMIEMLIYVIALLVVTIPFMLILGSYVKIISNILKLPSAIGRA
KAFSTCSSHVIVVALFFGSGIITYLRPKSSHSAGLDKFLSLFYTVVTPMFNPMIYCLRNK
DVMIALKKFLLRWLML