Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or12e10 Olfactory Receptor

Gene Symbol Or12e10
Organism Rat
Family 12
Subfamily e
Pseudo No
Location chr3:75970560-75971525 (+)
Aliases Olr592, Olr592

Sequence information


Nucleotide sequence

ATGACTGAGACTCTGACTAAATCATTCCTGCAGATGAAACATGAAGTTGAAGCAGAAGGC
AACATTTCTACAGTAATGCAATTTGTCCTGCTGGGATTCTCTGCTCTTCCCAACCTCCAA
GGAATTCTGTCTGCACTGTTCTCCCTCATTTACATGATTATCCTCACTGGTAATTGCCTC
ATCATATTAATAACTAGGCTTGACCATACATTGCAAAAACCGATGTATTTTTTCCTGGCA
AATTTTTCCTGTCTGGAAATCTGTTATGTATCAGTTACTGTCCCAAGAATTCTGTTCAAC
ATTTGGACACAGGATAGAAACATTTCAGTGCTGGCTTGTGCTGTGCAGATGTGTTTCTTT
CTTATGTTGGGAACCGATGAATGTTTCCTCCTGGCTGTGATGTCCTATGATCGCTATGTG
GCCATTTGCAATCCCTTGCACTATCCTGTGGTCATGAACTCAAAAAAGTGCACTCAGCTT
GCAGCAGGCTCCTGGATCAGTGGCATTCCAATTCAGATTGGACAAACTTGTTGGATATTC
TCTATGCATTTCTGCAATTCTAATGAAATAGACCATTTCTTCTGTGACATACCACCAATT
CTGAAGCTGGCATGTGGGGACACTTCAGTGCATGAACTGTCTGTCTATGTGGTTGTTATG
GTGGTGGCTGCTTTCCCCTTTATTCTGGTGCTAACATCCTACAGCAAAATCATTGCCACC
ATCCTGAGGTTGCCAACAGCCAAAGGGCGGGCAAAAGCCTTCTCCACATGTTCTTCTCAC
CTGCTGGTGGTGGTTTTGTTTTATGGATCTGGTACCATTACATACTTGAGGCCAAAGTCT
ATGCATAATCCTGGAACTGACAAACTGCTCTCTCTGTTCTATACCATTGTGACTCCCATG
TTCAATCCTCTAATATACACTCTTAGGAACAAGGAAGTTATTGTTGCCCTGAGAAAACTA
ATAGTC


Conceptual translation

MTETLTKSFLQMKHEVEAEGNISTVMQFVLLGFSALPNLQGILSALFSLIYMIILTGNCL
IILITRLDHTLQKPMYFFLANFSCLEICYVSVTVPRILFNIWTQDRNISVLACAVQMCFF
LMLGTDECFLLAVMSYDRYVAICNPLHYPVVMNSKKCTQLAAGSWISGIPIQIGQTCWIF
SMHFCNSNEIDHFFCDIPPILKLACGDTSVHELSVYVVVMVVAAFPFILVLTSYSKIIAT
ILRLPTAKGRAKAFSTCSSHLLVVVLFYGSGTITYLRPKSMHNPGTDKLLSLFYTIVTPM
FNPLIYTLRNKEVIVALRKLIV