Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or12e13-ps Olfactory Receptor

Gene Symbol Or12e13-ps
Organism Rat
Family 12
Subfamily e
Pseudo Yes
Location chr3:75980121-75980753 (+)
Aliases Olr593-ps, Olr593-ps

Sequence information


Nucleotide sequence

ATCGAGGACATTGAGAATGTTTCCACAGTGACTCAGTTTGTGCTCATAGGATTTTCTGAA
CTTCCCAGCCTCCAAGGGTTTCTATTTGCAGTGTTTTCTATCGTTTACATAATTATCCTG
GTTGGAAATTTCCTCATAATACTAATAACTAGTATGGATCCTGCATTACAGAAACCCATG
TATTTTTTTCTGGCAAATTTTTCCTCGCTGGAAATCTGTTATGTATCAGTTACTGTTCCA
AGGATTCTGTTCAGCCTCGAGAAACAGGACAGAAGCATTTCAATGATGTCCTGTGCCACA
CAACTGTGCTTCTTCCTTATTTTTGGAACTACTGAATGTTTGCTTTTGACTGTGATGTCC
TATGATCGCTATGTGGCCATCTGCAACCCTCTGCACTATCCTCTTATCATGAACCCAACA
AAGTGTACTCAGCTGGCAGCAGGCTCCTGGCTTGGAGGCATTCCAGTCCAGATAGGACAA
ACCTATCAGATATTTTCTATGCATTTTTGTAATTCTAACAAAATCAACCATTTCTTCTGT
GACATACCACCAATTCTGAAGCTGGCATGTGGGGACACTTCAGTACATGAACTGTCTATG
TGGTTGTTATGGTGGTCGCTGCTTTCCCCTTTA


Conceptual translation

IEDIENVSTVTQFVLIGFSELPSLQGFLFAVFSIVYIIILVGNFLIILITSMDPALQKPM
YFFLANFSSLEICYVSVTVPRILFSLEKQDRSISMMSCATQLCFFLIFGTTECLLLTVMS
YDRYVAICNPLHYPLIMNPTKCTQLAAGSWLGGIPVQIGQTYQIFSMHFCNSNKINHFFC
DIPPILKLACGDTSVHELSMWLLWWSLLSPL/LVLTSYSKIIATILRLPTAKGRAKAFS
TCSSHLLVVVLFYGSATVTYLRPKSMHSPGTDKLLSLFYTIVTPMFNLLIYSLRNKEVIA
ALRKLILQK