Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or12e13 Olfactory Receptor

Gene Symbol Or12e13
Organism Mouse
Family 12
Subfamily e
Pseudo No
Location chr2:87833041-87833982 (+)
Aliases Olfr1148, RP23-24F19.5, MOR264-7, RP23-24F19.5, MOR264-7

Sequence information


Nucleotide sequence

ATGAATCATGAAGAGCTAGAGTCCATAAACAATGTTTCCACAGTGATACAGTTTGTGCTC
ATAGGATTTTCTGACCTGCCCAACCTCCAAGGATTTCTATTTGCAGTGTTTTCTGTAGTT
TATATTATTATCTTGATTGGAAATTTCCTCATAATCATAATAATCAGTACGGACCAAGCA
TTACAGAAACCAATGTATTTTTTTCTGGCAAATTTTTCCTCTCTGGAAATCTGTTATGTA
TCAGTGACTGTCCCAAGGATTCTGTTCAACATTGGGACACAGAACCGAAGCATTTCACTG
ATGTCCTGTGCTACACAACTGTGCTTCTTCCTTGTTTTTGGAACTACTGAATGTTTGTTG
CTAGCTGTGATGTCCTATGACCGATATGTGGCCATATGCAACCCTCTGCACTATCCTCTG
GTCATGAACCCAACAAAGTGCACACAGCTGGCAGCAGTCTCCTGGCTTGGAGGCATCCCA
GTCCAGATAGGACAAACTTGTCAGATATTCTCTATGAATTTTTGTAATTCTTACAAAATC
AACCACTTCTTTTGTGACATACCACCAATTCTCACGCTGGCTTGTGGAAACACTTCAGTG
CATGAATTGTCTGTCTATGTGGTCGTTATGGTGGTGGCTGCATTCCCCTTTATATTGGTG
CTTACATCCTACAGCAAAATCATTGCCACCATCCTGAGGTTGCCAACAGCCAAAGGTCGG
GGAAAAGCCTTCTCCACATGTTCTTCCCACCTGCTGGTGGTACTATTGTTTTATGGATCT
GCTACGGTTACCTATTTGAGACCAAAGTCCATGCATTCTCCTGGAACTGACAAACTCCTG
TCTCTGTTCTACACCATTGTGACTCCCATGTTCAATCCCTTAATATACAGCCTTAGGAAC
AAGGAAGTGATTGCTGCACTGAGAAAGTTAATACTAAAAAAA


Conceptual translation

MNHEELESINNVSTVIQFVLIGFSDLPNLQGFLFAVFSVVYIIILIGNFLIIIIISTDQA
LQKPMYFFLANFSSLEICYVSVTVPRILFNIGTQNRSISLMSCATQLCFFLVFGTTECLL
LAVMSYDRYVAICNPLHYPLVMNPTKCTQLAAVSWLGGIPVQIGQTCQIFSMNFCNSYKI
NHFFCDIPPILTLACGNTSVHELSVYVVVMVVAAFPFILVLTSYSKIIATILRLPTAKGR
GKAFSTCSSHLLVVLLFYGSATVTYLRPKSMHSPGTDKLLSLFYTIVTPMFNPLIYSLRN
KEVIAALRKLILKK