Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or12e13b Olfactory Receptor

Gene Symbol Or12e13b
Organism Rat
Family 12
Subfamily e
Pseudo No
Location chr3:75987763-75988728 (+)
Aliases Olr594, Olr594

Sequence information


Nucleotide sequence

ATGAAGGGAAACATAGAGAATGTTTCCACAGTGATGCAATTTGTGCTCATAGGATTTTCT
GACTTTCCCAACCTCCAAGGGTTTCTACATGCAGTGTTTTCTGTAGTTTATATAATTATC
CTGGTTGGAAATTTCCTCATAATACTAACAACCAGTATGGACCCTGCATTACAGAAACCC
ATGTATTTTTTCCTGGCAAACTTTTCCTCTCTGGAAATCTGTTATGTATCAGTTACTGTC
CCAAGGATTCTGTTCAACCTTGAGAAACAGGACAGAAGCATTTCACTGATGTCCTGTGCC
ACACAGCTGTGCTTCTTCCTTATTTTTGGAACTACTGAATGTTTGCTGCTGACTGTGATG
TCGTATGACCGCTATGTGGCCATCTGCAACCCTCTGCAATATCCACTGGTCATGAACCCA
AAAAGGTGCACACAGATGGTGGCAGTCTCCTGGCTGGGAGGTATCCCAGTCCAGATAGGA
CAAACTTATCAGATATTCTCTATACCTTTTTGTTATTCGAATCAAATAGACCATTTCTTT
TGTGACATACCACCAATTCTCAAGCTGGCAGGTGGAGACACTTCTGTACACGAACTGTCT
GTTTATTTGGTTGTTTCCATGGTAGTTGCTTTCCTCTTCATATTGGTGCTTACATCCTAC
AGCAAAATCATTGCCACCATCCTGGGCTTGCCAACAACCAAAGGGCGGGCAAAAGCCTTC
TCCACATGTTCTTCGCACCTGCTGGTGGTGGTGTTGTTTTATGGATCTGCTACAGTTACC
TATTTGAGACCAAAGTCCAGGCATTCTCCTGGAACTGACAAAGTGTTCTCTCTGTTCTAT
GCAATTGTGATTTCTATGTTAAATCCGCTAATATACAGCCTTAGAAACAAGGAAGTGACT
GCTGCTATGAGAAAGTTAATATTCCAAATTAGGGACTTGTGTAGGCATAGAAGTTTATTA
TTTTTC


Conceptual translation

MKGNIENVSTVMQFVLIGFSDFPNLQGFLHAVFSVVYIIILVGNFLIILTTSMDPALQKP
MYFFLANFSSLEICYVSVTVPRILFNLEKQDRSISLMSCATQLCFFLIFGTTECLLLTVM
SYDRYVAICNPLQYPLVMNPKRCTQMVAVSWLGGIPVQIGQTYQIFSIPFCYSNQIDHFF
CDIPPILKLAGGDTSVHELSVYLVVSMVVAFLFILVLTSYSKIIATILGLPTTKGRAKAF
STCSSHLLVVVLFYGSATVTYLRPKSRHSPGTDKVFSLFYAIVISMLNPLIYSLRNKEVT
AAMRKLIFQIRDLCRHRSLLFF