Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or12e7 Olfactory Receptor

Gene Symbol Or12e7
Organism Mouse
Family 12
Subfamily e
Pseudo No
Location chr2:87457167-87458108 (+)
Aliases Olfr1126, RP23-178B19.4, MOR264-5, RP23-178B19.4, MOR264-5

Sequence information


Nucleotide sequence

ATGAAATTCACAGAAATCAGGGCAGAGGACAATGCTTCCACTGTGACAGAGTTTCTCCTC
CTGGGATTTTCTGACCTTCCTAACTTACAAGGGATTTTGTTTGGGTTGTTCTCCATAATT
TACTTGATCATATTGATTGGAAATAGTTTCATAATTGTGATAACTAGAATTGATCCTGCA
CTACAGAAGCCCATGTATTTTTTCCTGGCAAATTTTTCTTCTCTGGAAATCTGTTATGTA
TCAGTCACTCTCCCTAGGATTCTGTTTAACATTGCTACTCAAGACAGAAGCATTTCTGTG
GTGAGCTGTGCCACACAAATGTGTTTCTTCCTTATGCTGGGAGCTACTGAGTGTTTCCTG
CTGGCTGTGATGTCCTATGATCGCTATGTGGCCATCTGCAATCCTCTGCACTATCCTCTG
GTCATGAACCCAACAAAGTGCACTCAGCTGGCAGCAGCCTCCTGGCTTGGAGGCATCCCT
GTCCAGATAGGACAAACCTGTCAGATATTTTCTCTACATTTCTGCAATTCTAACCAAATA
GATCACTTCTTTTGTGACTTACCTCCCATTCTCAAGCTGGCCTGTGGAGATACTTCAATA
CACGAGTTGTCTGTCTACTTAGTAGCTATGCTGTTTGTTGCATTCCCTTTCTTGTTGATA
CTTGCCTCTTATACCAAAATCATTGCCACCATTCTGAAGTTGCCAACAGCCACAGGACGG
GCAAAAGCCTTCTCAACATGTTCTTCCCATTTGCTTGTGGTGTTTTTGTTTTTTGGATCA
GCTACTATTACCTACTTGAGGCCAAAGTCCACCCATTCTCCAGGAACTGATAAACTACTC
TCTTTGTTTTACACCATTGTGACTCCCATGTTCAATCCTCTGATATACAGTCTTAGAAAT
AAGGAGGTGATTGCTGCACTGAGAAAACTGTTACATATCAAG


Conceptual translation

MKFTEIRAEDNASTVTEFLLLGFSDLPNLQGILFGLFSIIYLIILIGNSFIIVITRIDPA
LQKPMYFFLANFSSLEICYVSVTLPRILFNIATQDRSISVVSCATQMCFFLMLGATECFL
LAVMSYDRYVAICNPLHYPLVMNPTKCTQLAAASWLGGIPVQIGQTCQIFSLHFCNSNQI
DHFFCDLPPILKLACGDTSIHELSVYLVAMLFVAFPFLLILASYTKIIATILKLPTATGR
AKAFSTCSSHLLVVFLFFGSATITYLRPKSTHSPGTDKLLSLFYTIVTPMFNPLIYSLRN
KEVIAALRKLLHIK