Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or12e7 Olfactory Receptor

Gene Symbol Or12e7
Organism Rat
Family 12
Subfamily e
Pseudo No
Location chr3:75518280-75519221 (+)
Aliases Olr566, Olr566

Sequence information


Nucleotide sequence

ATGAAATCCACAGAAATCAGGGCAGAGGACAACGCTACCACTGTGACACAGTTTCTCCTC
CTGGGATTTTCAGACCTTCCTAACTTACAAGGGATTCTGTTTGGGATGTTCTCCATAATT
TACTTAATCATCTTGATTGGAAATAGTTTCATAATTGTGATAACTAGAATTGATCCTGCA
CTACAGAAGCCCATGTATTTTTTCCTGGCAAATTTTTCTACTCTTGAAATCTGTTATGTA
TCAGTCACACTTCCTAGGATTCTGTTCAACATTGCTACTCAAGACAGAAGCATATCTGTA
CTGAGCTGTGCCACACAAATGTGTTTCTTCCTGATGCTGGGAGCCACTGAGTGTTTCCTG
CTGGCTGTGATGTCCTATGACCGCTATGTGGCCATCTGTAATCCTCTGCACTATCCTCTT
GTCATGAACCCAACAAAGTGCACTCGGCTGGCAGCAGGCTCCTGGCTGGGAGGTATCCCA
GTCCAGATAGGACAAACCTGTCAGATATTCTCTCTACGTTTTTGCAATTCTAACCAAATA
AAACATTTCTTTTGTGACTTACCGCCCATTCTCAAGCTGGCCTGTGGGGATACTTCAATA
CATGAGCTGTCTGTCTACTTAGTGGCTATGCTGTTTGTTGCTTTCCCTTTCACACTGATA
CTTGCCTCTTACAGCAAAATCATTGCCACCATTCTGAAGCTGCCAACAGCCACAGGACGG
GCAAAAGCATTTTCCACATGTTCTTCCCATTTGCTTGTGGTGTTTTTGTTTTTTGGATCA
GCTACTGTTACCTATTTGAGGCCAAAATCTACCCATTCTCCAGGAATTGACAAACTGCTG
TCTCTGTTTTACACTATTGTGACTCCCATGTTCAATCCACTGATATACAGCCTTAGAAAC
AAGGAAGTGATTGCTGCACTGAAAAAGCTGTTACCTAAAAAG


Conceptual translation

MKSTEIRAEDNATTVTQFLLLGFSDLPNLQGILFGMFSIIYLIILIGNSFIIVITRIDPA
LQKPMYFFLANFSTLEICYVSVTLPRILFNIATQDRSISVLSCATQMCFFLMLGATECFL
LAVMSYDRYVAICNPLHYPLVMNPTKCTRLAAGSWLGGIPVQIGQTCQIFSLRFCNSNQI
KHFFCDLPPILKLACGDTSIHELSVYLVAMLFVAFPFTLILASYSKIIATILKLPTATGR
AKAFSTCSSHLLVVFLFFGSATVTYLRPKSTHSPGIDKLLSLFYTIVTPMFNPLIYSLRN
KEVIAALKKLLPKK