Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or12e7b-ps Olfactory Receptor

Gene Symbol Or12e7b-ps
Organism Rat
Family 12
Subfamily e
Pseudo Yes
Location chr3:75489914-75490885 (+)
Aliases Olr564-ps, Olr564-ps

Sequence information


Nucleotide sequence

ATTGGAAATTTTGAACCTGTGTTATCATTACTTTATATGTGAGATAAAGAGTCCAAGGAC
AAGGAACTATTTCTCACTTTTGCTTGAATAATTCCCACAGATGAAATTCATAGAAATCTG
GACTAAGAAAAATACTTCCACTGTGACACAGTTTCTCCTCCTGGGATTTTCAGACCTTCC
CAACCTCCAAGGATTTCTGTTTGGAATGTTCTCCATAGTTTACTTGATTATCTTGATTAG
AAATGGTTTCATAATTGTGAAAACAAGAATTGATCCTGTACTACAGAAGCCCATGTATTT
TTTTTCCTGGCAAATTTTTCTACTCTGGAAATCTGTTATGTATCAGTCACACTTCCTAGG
ATTCTGTTCAACATTGCTACTCAAGACAGAAGCATATCTGTGTCGAACTGGGCCATACAA
ATGTGCTTTTTCATTATGCTGGGGACCACTGAGTGTTTCCTGCTGGCTGTGATGTCCTAT
GACCGCTATGTGGTCATCTGCAACCCTCTGCCCTATCCTCTTCTCATGAACCCAACAAAG
TGCACTCAGCTGGCTGCAGGTTCCTGGCTGGGAGGCATTCCATTCCAGATAGGACAAACC
TGTCAGATATTCTCTCTACATTTCTGCAATTCTAACCAAATACACCACTTCTTTTGTGAC
TTACCGCCCATTCTCAAGCTGGCCTTTTGGGATACTTCAATGCATGAGCTGTCTGTTTAC
TTAGTGGCTATGCTCTTTGTTGTTTTTCCTTTTATGTTGATACTTTCCTCTTACAGCAAA
ATCATTGCCACCATTCTGAAATTGCCAACAGCCACAGGATGGGCAAAAGCATTTCCCACA
TGTTCTTCCCATTTGCTTGTGGTGTTTTTGTTTTTTTGGATCAGCTACTGTTTCATACTT
GAGGCCAAAATCCACTCATTCTCCAGGAACTGACAAATTGCTGTCTCTGTTTTACACTAT
TGTGACTCCAAT


Conceptual translation

EIWTKKNTSTVTQFLLLGFSDLPNLQGFLFGMFSIVYLIILIRNGFIIVKTRIDPVLQKP
MYFF/LANFSTLEICYVSVTLPRILFNIATQDRSISVSNWAIQMCFFIMLGTTECFLLA
VMSYDRYVVICNPLPYPLLMNPTKCTQLAAGSWLGGIPFQIGQTCQIFSLHFCNSNQIHH
FFCDLPPILKLAFWDTSMHELSVYLVAMLFVVFPFMLILSSYSKIIATILKLPTATGWAK
AFPTCSSHLLVVFLFF\SATVSYLRPKSTHSPGTDKLLSLFYTIVTP