Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or12e9 Olfactory Receptor

Gene Symbol Or12e9
Organism Mouse
Family 12
Subfamily e
Pseudo No
Location chr2:87371444-87372475 (+)
Aliases Olfr1121, RP24-388A9.12, MOR264-18, RP24-388A9.12, MOR264-18

Sequence information


Nucleotide sequence

ATGAAGAAAGAAATGTATTTACTTCAGTTTCTGAATGATATATCAAGGCCGAGAATAAGG
AAGTGTACTTTGATTGAATCATCCCCACAGATGAAACACACTGACATCAGGGAAGAGGAC
AACGCTTCCGCAGTGACACAGTTTCTTCTGCTTGGATTTTCTGACCTTCCAAACCTCCAG
AGCTTTCTGTTTGGGGTGTTCTCCATAATGTACTTGATTATGCTAATTGCAAATAGCTTC
ATAATTGTGATAACCAAGCTTGACCCTACACTACAGAAGCCCATGTATTTTTTCCTGGTC
AACTTTTCTTTTCTGGAAATCTGTTATGTATCAGTCATTCTCCCTAGGGTTCTGTACAGC
ATTTGGACCCAAGACAGAAATATTTCTCTTTTGGCCTGTGCCACACAAATGTGCTTCTTC
CTAATGTTGGCAGCCACTGAAAGTATTTTTCTCGCTGTGATGTCCTATGACCGCTATGTG
GCCATCTGTAGTCCTCTGCACTATCCTCTGGTCATGAGTCCAAGAAAATGCAGGCAGCTG
GCAGCAGGGTCCTGGCTCGGTGGCATGCCGTTTCAGGTTGGGCAAACCTGTCAAATATTC
TCTCTACATTTCTGTAACTCTAACCAAATAGAACACTTCTTCTGTGACATACCCCCTGTG
CTTAAACTGGCCTGTGGAGACACTTCTGTTATTGAGATGTATGTCTATGTAGTGGCTATC
CTGCTTGCAGCAATCCCTTTTATACTAATACTAACATCTTACAGCAAAATCATTGCCACC
ATCCTGAGGCTGCCAACTGCTGAAGGACGATCGAAAGCCTTCTTCACATGTTCTTCCCAC
CTAGTGGTGGTGGTTTTGTTTTTTGCCCCTGCATCTATTACCTACTTAATGCCAAAATCA
TCTCATTCTGCAGTAAGTGACAAATTCCTTTCTCTTTTCTACACCATCATCACCCCCGTG
TTCAATCCCATGATATACAGCCTTAGGAACAAAGAGGTAATTGCAGCTCTGAGAAGATTG
TTGCTTACAACA


Conceptual translation

MKKEMYLLQFLNDISRPRIRKCTLIESSPQMKHTDIREEDNASAVTQFLLLGFSDLPNLQ
SFLFGVFSIMYLIMLIANSFIIVITKLDPTLQKPMYFFLVNFSFLEICYVSVILPRVLYS
IWTQDRNISLLACATQMCFFLMLAATESIFLAVMSYDRYVAICSPLHYPLVMSPRKCRQL
AAGSWLGGMPFQVGQTCQIFSLHFCNSNQIEHFFCDIPPVLKLACGDTSVIEMYVYVVAI
LLAAIPFILILTSYSKIIATILRLPTAEGRSKAFFTCSSHLVVVVLFFAPASITYLMPKS
SHSAVSDKFLSLFYTIITPVFNPMIYSLRNKEVIAALRRLLLTT