Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or12e9 Olfactory Receptor

Gene Symbol Or12e9
Organism Rat
Family 12
Subfamily e
Pseudo No
Location chr3:75390030-75390971 (+)
Aliases Olr559, Olr559

Sequence information


Nucleotide sequence

ATGAAACACACAGACATCAGGGAAGAGGACAATGCCTCCACAGTGACACAGTTTCTTCTG
CTTGGATTTTCTGATCTTCCCAACCTCCAGAGCTTTCTATTTGGGATATTCTCTATAATG
TACTTGATTATACTAATTGCCAATAGTTTCATAATTGTTATAACCACACTGGATCCTGCA
CTACAGAAACCCATGTATTTTTTCCTGGTCAACTTTTCTTTTCTGGAAATCTGTTATGTA
TCAGTCATTCTCCCTAGGATTCTGTACAGCATTTGGACACACAACAGAAATATTTCTCTT
CTGGCTTGTGCTATACAAATGTGCTTCTTCCTAATGCTGGCAGCCACTGAAAGTATTCTC
CTGGCCGTGATGTCCTATGATCGCTATGTGGCCATCTGTAATCCTCTGCACTATGCTCTG
GTCATGAACCCAAGAAAATGCAGGCAGCTGGCAGCAGGGTCCTGGCTCGGTGGCATGCCA
TTCCAGCTTGGGCAAACCTGTCAAATATTCTCTCTACATTTCTGTAACTCTAACCAAATA
GATCACTTCTTCTGTGACATACCTCCTGTACTTAAACTGGCCTGTGGAGACACTTCTGTT
AATGAGATGTATGTCTATGTAGTGGCTATCTTGCTTGCTGCAATCCCTTTTATACTAATA
CTAACATCGTACAGCAAAATTATTGCCACCATCCTGAGGCTGCCAACAGCAGAAGGACGA
GCAAAAGCCTTCTCCACATGTTCTTCCCACCTAGTGGTTGTAGTTTTGTTTTTTGCCTCT
GCATCTATTACCTACTTAATGCCAAAATCAACTCATTCTGCAGTAAGTGACAAATTCCTT
TCTCTTTTCTACACCATTGTCACCCCCATTTTCAATCCCATGATTTATTGCCTTAGGAAC
AAAGAGGTTATTGCAGCTCTGAGAAGATTATTGCTTAGAACA


Conceptual translation

MKHTDIREEDNASTVTQFLLLGFSDLPNLQSFLFGIFSIMYLIILIANSFIIVITTLDPA
LQKPMYFFLVNFSFLEICYVSVILPRILYSIWTHNRNISLLACAIQMCFFLMLAATESIL
LAVMSYDRYVAICNPLHYALVMNPRKCRQLAAGSWLGGMPFQLGQTCQIFSLHFCNSNQI
DHFFCDIPPVLKLACGDTSVNEMYVYVVAILLAAIPFILILTSYSKIIATILRLPTAEGR
AKAFSTCSSHLVVVVLFFASASITYLMPKSTHSAVSDKFLSLFYTIVTPIFNPMIYCLRN
KEVIAALRRLLLRT