Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or12j2 Olfactory Receptor

Gene Symbol Or12j2
Organism Mouse
Family 12
Subfamily j
Pseudo No
Location chr7:140335864-140336778 (+)
Aliases Olfr527, MOR251-5

Sequence information


Nucleotide sequence

ATGATGAATGGGACACTGGTCACTGAGTTCCTCATCCTGGGATTCTCAGAAATGCCTCAC
CTTCGGGTACCTCTTCTCTTCAGCTTCCTCTGCCTATACATGGCTGCAATCTCAGGAAAC
TTGCTCATTATGGTGACAATCAGTGCCAGCCCAGCCCTGCATACCCCCATGTACTTCTTC
CTGGTCAACTTGGCCATTGTGGACATCCTCTGCACCTCCACCATCCTACCCAAACTACTG
GACAGCATGATGACAGGAAGGACCATCTCTTACGGGGGCTGCATGGCCCAGCTCTTCTTC
TTCACATGGTCACTGGGAGCAGAGCTTCTGCTCTTCTCAGCTATGGCCTATGACCGCTTT
GTGGCCATCTGCTGTCCCCTGCACTACAGTGCTTGGATGGGCCCCAGGGTGTGTGCATTC
CTGGCTGGCATTGTCTGGACTATCAGCCTGACTAACACCAGCGTGCACACAGGCCTGATG
TTGCGTCTACCATTCTGCAGCTCCAATGTGATAGAGCACTTCTTCTGTGAGATTCCCCCA
CTGTTGAAGCTTTCCTGTGCTCCAACGCAATTGAATGAGGCCATGGCCTTCGCTGCGGAT
GTGTTCCTGGCTGTAGGGAACTTCTCTGTGACAATCCTCTCCTATGGCTTTATTGTGGCC
AGCATCCTGAAGATCCGGTCAGCTGAGGGCAAGCGACGAGCCTTCTCCACCTGCTCTGCA
CACCTTATCGTGGTCACCATGTACTACTCCACTGTCATCTACACCTACATTCGCCCTTCA
TCCAGCTACTCACTGAACAAGGACAAGGTGGTGTCCATCATCTACACCTCAGTGGCACCC
ACCTTGAACCCCCTCATCTACACCCTGAGGAACAAGGATGTCAAAGTTGCACTCCGGAGA
CTTCTCTCCTGCTGC


Conceptual translation

MMNGTLVTEFLILGFSEMPHLRVPLLFSFLCLYMAAISGNLLIMVTISASPALHTPMYFF
LVNLAIVDILCTSTILPKLLDSMMTGRTISYGGCMAQLFFFTWSLGAELLLFSAMAYDRF
VAICCPLHYSAWMGPRVCAFLAGIVWTISLTNTSVHTGLMLRLPFCSSNVIEHFFCEIPP
LLKLSCAPTQLNEAMAFAADVFLAVGNFSVTILSYGFIVASILKIRSAEGKRRAFSTCSA
HLIVVTMYYSTVIYTYIRPSSSYSLNKDKVVSIIYTSVAPTLNPLIYTLRNKDVKVALRR
LLSCC