Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or12j3 Olfactory Receptor

Gene Symbol Or12j3
Organism Mouse
Family 12
Subfamily j
Pseudo No
Location chr7:140372688-140373608 (-)
Aliases Olfr530, MOR252-2

Sequence information


Nucleotide sequence

ATGGCGCTGGTAAACCAGTCGGTTGTGACCATGTTCATCCTGCAAAGGTTTGTTGATGAC
CCCTGGATCCAGGATGTTCTCTTCTGCCTCTTCTTTGCCTTGTTCATGGCAGCCATAGCT
GGCAATGGCCTGATCATCGCAACCATCCACAGCAGTCCCAACCTCCACACTCCCATGTAC
TTCTTCCTTGTCAATCTTTCCCTGATGGATGTGATCTGCACTGTGACTGTCTTGCCCAAA
GTCCTGCAGAGCCTGGTGGCAGAGAACAGCATATCTTATGGGGGATGCCTCACACAGATG
TTCGTCTTCTCCTGGGTCCTGGGCTCTGAGCTTCTGCTTTTCTCTGCCATGGCCTATGAC
CGCTACCTTGCAATCTGTCGGCCACTGCACTATGGCACCCTCATGAGCGGCAAGGTCTGT
GTGGCCCTTGCAACCTTTGTGTGGTTCACTGGAGCTCTCAATTCCTTGGTGCTCACTTGT
CTGATGTTGCCATTGTCTTTCTGTGGTCCCAATCTCATCACACACTTCTTCTGTGAGATC
CCTTCTGTATTGATACTGTCCTGCAGTCCCACCTTTATCAATGACATCATGACTGTTATT
ACAGACATGTTCCTGACAGGCCTAAACTTCCTGTTGACTATGACATCCTATGTCTTCATC
ATCGCCAGCATCCTGCGCATCCGCTCAGCTGAGGGCAAAAAGCGTGCCTTCTCCACCTGC
TCTGCCCACCTGGTTGTGGTCACCCTTTATTATTCCACTGTTCTCTATACTTATGTCCGG
CCAGCCCTAGGAACTGCTGGGTTCCTGGACAAACTCATTGCTGTTCTGTACACCACTGTG
ACCCCATCTCTGAACCCCCTTATCTATACCCTGAGAAATAAGGAATTTAAAATATCCTTT
AAAAAACTCTTATTTCCCCAT


Conceptual translation

MALVNQSVVTMFILQRFVDDPWIQDVLFCLFFALFMAAIAGNGLIIATIHSSPNLHTPMY
FFLVNLSLMDVICTVTVLPKVLQSLVAENSISYGGCLTQMFVFSWVLGSELLLFSAMAYD
RYLAICRPLHYGTLMSGKVCVALATFVWFTGALNSLVLTCLMLPLSFCGPNLITHFFCEI
PSVLILSCSPTFINDIMTVITDMFLTGLNFLLTMTSYVFIIASILRIRSAEGKKRAFSTC
SAHLVVVTLYYSTVLYTYVRPALGTAGFLDKLIAVLYTTVTPSLNPLIYTLRNKEFKISF
KKLLFPH