Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or12j5 Olfactory Receptor

Gene Symbol Or12j5
Organism Rat
Family 12
Subfamily j
Pseudo No
Location chr1:213,095,000-213,095,000 (-)
Aliases Olr303

Sequence information


Nucleotide sequence

ATGGCTTCTGGAAACCAGTCAGCTATTACCATGTTCATCCTGCAAAGCTTTATTGATGAC
CCCTGGATCCAGAATGTTCTCTTTTGCCTTTTCTTTGCCTTGTTCGTGGCAGCCATAGCT
GGCAATGGCCTGATTATCACAGTCATCCACAGCAGTGCCAACCTCCACACTCCCATGTAC
TTCTTCCTAGTCAATCTTTCCCTCATGGATGTGATCTGCACTGTGACTGTCTTGCCTAAA
GTCCTGCAGAGCCTGGTGGCAGAGAACGCCATTTCTTATGGGGGATGTCTCACACAAATG
TTCATCTTCACCTGGGTACTGGGCTCTGAGCTTCTGCTTTTTTCTGCCATGGCCTATGAC
CGCTACCTTGCAATCTGCCGGCCACTGCACTATGGTACCCTCATGAGTGGCAGGGTCTGC
ATGGCCCTTGCAACCTTTGTGTGGTTCATTGGAGCTCTCAATTCCTTGGTGCTCACTTGT
CTGGTGTTGCCACTGTCCTTCTGTGGTCCTAATCTCATCACACACTTCTTCTGTGAGATC
CCCTCCGTGTTGACACTGTCCTGCAGCCCCACATTTACCAATGACATCATGACTGTTGTT
GCAGACATGTTCCTGACAGGCCTGAACTTCCTATTGACCATGACATCCTATGTGTTCATC
ATTGCCAGCATCCTGCGCATCCGCTCAGCTGAGGGCAAGAAGCGCGCCTTCTCCACCTGC
TCTGCTCACCTGGTTGTGGTCACCCTTTATTATTCCACTGCTCTATATACTTATGTCCGG
CCAGCCCTAGGAAATGCTGGACTCCTGGACAAGTTCATTGCTATTCCATACACCACTGTG
ACCCCGTCTCTGAACCCTCTCATCTATACTCTGAGAAACaaagaattcaaaacatccttt
aaaagacttttatttgcccat


Conceptual translation

MASGNQSAITMFILQSFIDDPWIQNVLFCLFFALFVAAIAGNGLIITVIHSSANLHTPMY
FFLVNLSLMDVICTVTVLPKVLQSLVAENAISYGGCLTQMFIFTWVLGSELLLFSAMAYD
RYLAICRPLHYGTLMSGRVCMALATFVWFIGALNSLVLTCLVLPLSFCGPNLITHFFCEI
PSVLTLSCSPTFTNDIMTVVADMFLTGLNFLLTMTSYVFIIASILRIRSAEGKKRAFSTC
SAHLVVVTLYYSTALYTYVRPALGNAGLLDKFIAIPYTTVTPSLNPLIYTLRNKEFKTSF
KRLLFAH