Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or12k5 Olfactory Receptor

Gene Symbol Or12k5
Organism Mouse
Family 12
Subfamily k
Pseudo No
Location chr2:37004623-37005612 (-)
Aliases Olfr358, GA_x6K02T2NLDC-33697309-33696317, MOR159-4

Sequence information


Nucleotide sequence

ATGGCCACTAAAAACAAGACAGAAGTGACTGAGTTTGTGTTGTTGGGATTGTCCAGTAGG
CCAGAGATGCAGCCAGTTATTTTTGGAGTTGTCCTTATCATGTACCTGGCAGCAGTTTTG
GGCAATACCTTACTAGTGCTTGTTGCTTGCTCAGACCCCAGGCTTCAGACCCCCATGTAC
TTCCTTCTCAGCCAGCTTTCCTTGATTGACATATGTCTAACAACCATCACTGTTCCTCAG
ATGCTGGTACACACACTCTCTGTGGTTCGAAGCATTTCTTATAACTGTTGCATGACACAA
TTATTTTTCTTTATGGCAGTGGGCAGCATGGAAGGCCACTTACTGGCTGCCATGGCATAT
GACCGCTATGTTGCCATCTGTGACCCTTTAAGATACTCTGCTATTGTCAGCCATAGCCTC
TGTCTGCGAATAACATTGACCTCATGGGTGGTGGTCAGCCTTAACAGTCTCCTGTACAGT
GTGTTGGTCACTCGTTTAACCTTCTGTGGCAACCAGGTCACCCACTTCTTCTGTGACATC
ACTCCTCTGCTGAAGCTCTCTTGTACTCGACCAGTGGTCAATGAAATGTTAATTTTCACT
GAGGGTGTAGCTGTGGTTGTCAGCCCCTTTTTCTTCATTTTGGGCTCCTACATTCGCATA
GGTTTTGTTATTGCCCACATGCATTCAACTGCTGCCCTGAGCAAAGCTCTGTCTACCTGT
GGCTCCCACATTATGGTTGTGTTGCTCCTGTATGGTTCTGTGATTCGCATGTACCTCAAG
CCATCGTCTACCTATGACTTAAACCAGGATCGACAGATTGCCATCTTCTACACATTGGTC
ACCCCTATGCTAAATCCATTAATCTATAGCCTCAGGAACCAGGAAGTTAAAGGAGCTCTC
ACACGGCTTCTTAGGAAACTCTGCATCTCAGGAAGCTTCCAGGTTGGCTCAGATAAAGAA
AGAATGACAAATATTATGAGACCTAATGTT


Conceptual translation

MATKNKTEVTEFVLLGLSSRPEMQPVIFGVVLIMYLAAVLGNTLLVLVACSDPRLQTPMY
FLLSQLSLIDICLTTITVPQMLVHTLSVVRSISYNCCMTQLFFFMAVGSMEGHLLAAMAY
DRYVAICDPLRYSAIVSHSLCLRITLTSWVVVSLNSLLYSVLVTRLTFCGNQVTHFFCDI
TPLLKLSCTRPVVNEMLIFTEGVAVVVSPFFFILGSYIRIGFVIAHMHSTAALSKALSTC
GSHIMVVLLLYGSVIRMYLKPSSTYDLNQDRQIAIFYTLVTPMLNPLIYSLRNQEVKGAL
TRLLRKLCISGSFQVGSDKERMTNIMRPNV