Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or12k6-ps Olfactory Receptor

Gene Symbol Or12k6-ps
Organism Mouse
Family 12
Subfamily k
Pseudo Yes
Location chr2:37019242-37020202 (-)
Aliases Olfr359-ps1, MOR159-2P

Sequence information


Nucleotide sequence

GCCACTAAAAACAAGACAGAAGTGACTGAATTTGTGTTGTTGGGATTGTCCAGTAGGCCA
GAGATGCAGCCAGTTATTTTTGGAGTTATCCTACCTGACAGCAGTTTTGGGCAATACCCT
ACTAGTGCTTGTTGTTTGCTCAGACCCAAAGCTTCAGACCCCCATGTACTTCCTTCTCAG
CCAGCTTTCCTTGATTGCCATATGTCTAACAACCATCACTGTTCCTCAGATGCTGGTACA
CACACTCTCTGCGGTTCGAAACATTTCTTATAACTGTTGCATGACACAATTATTTTTCTT
TATGGCAGTGGGCAGCATGGAAGGCCACTTACTGGCTGACATAGCATAGGACTACTATGT
TGCCATCTGTGACCCTTTAAGATATTATGCTATTGTTAGCCATAGCCTCTGTCTGCAAAT
AACATTGACCTCATGGGTGATGGTCAGCCTTAACAGTCTCCTGTACAGTGTGTTGGTCAC
TCGTTTAACCTTCTGTGGCAACAAGGTCACTCACTTTTTCTGTGACATCACTCCTCTGCT
GAAGCTCTCTTGTACTCGACCAGTGCTTAATGAAATGCTAATCTTCACTGAGGGTGCTGC
TGTGGTGGGTAGTCCTTTCTTCTTAATTTGGGGTTCTTATGCTCGAATAGGTATTGCCAT
GGCCCACATGCACTCCTTTGCTGCCCTGAAGAAAGCTTTGTCTACCTGTAGCTCCCACAT
TCTGATTGTGCTGCTCCTTTTTGGCTCTTTGGCTAGAATGTACCTTAAGCCATCATCCAG
CTATGACTTAGACCAGGATCACCAGGTTGCCATCTTCTACATGCTCATCTCCCCTATGTT
AAATCCACTAATATACAGCCTTAGGAACCAAGATGTTAAAGGAGCACTATGGAGGCTTTT
TAGGAAACTCCATACTTCAGACTGGCTCTTAGAAAAACAAAGAATGAGAAACAAATTCAT
G


Conceptual translation

ATKNKTEVTEFVLLGLSSRPEMQ\LFLELSYLTAVLGNTLLVLVVCSDPKLQTPMYFLL
SQLSLIAICLTTITVPQMLVHTLSAVRNISYNCCMTQLFFFMAVGSMEGHLLADIA*DYY
VAICDPLRYYAIVSHSLCLQITLTSWVMVSLNSLLYSVLVTRLTFCGNKVTHFFCDITPL
LKLSCTRPVLNEMLIFTEGAAVVGSPFFLIWGSYARIGIAMAHMHSFAALKKALSTCSSH
ILIVLLLFGSLARMYLKPSSSYDLDQDHQVAIFYMLISPMLNPLIYSLRNQDVKGALWRL
FRKLHTSDWLLEKQRMRNKFM