Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or12k7 Olfactory Receptor

Gene Symbol Or12k7
Organism Mouse
Family 12
Subfamily k
Pseudo No
Location chr2:37068307-37069257 (+)
Aliases Olfr360, MOR159-1

Sequence information


Nucleotide sequence

ATGGCCACTAAAAACAAGACAGAAGTGACTGAGTTTGTGTTGTTGGGATTGTCCAGTAGG
CCAGAGATACAACCAGTTATTTTTGGAGTTGTCCTTATCATGTACCTGATGGCAGTTTTG
GGCAATACTCTACTAATACTTGTTGCTTGTTCAGATCCCAGGCTTCAGACCCCCATGTAC
TTCCTTCTCAGCCAGCTGTCCTTGATTGACATATCTTTAACAACCATCACTATTCCTCAG
ATGCTAGTGCACACACTCTCTGTAAATCGGAGCATTTCCTATAATCGTTGCATGACACAA
TTATTTTTCTTTATGGCAGTGGGCAGCATGGAAGTCTACTTGCTGGGTGCAATGGCATAT
GACCGCTATGTTGCCATCTGTGACCCTTTAAGATACTCTGCCATTGTCAGCTATAGCCTC
TGTCTGCAAATAACATTGACCTCATGGATGGTGGTCAGCCTTAACAGTCTCCTGTACAGT
GTGTTAGTCACTCGTTTAACCTTCTGTGGCAACAAGGTCACTCACTTCTTCTGTGACATC
ACTCCTCTGCTGAAGCTCTCTTGTACTCGACCAGTGCTTAATGAAATGCTAATCTTCACT
GAAGGTGTAGCTGTGGTGGGTAGCCCCTTCTTCTTCATTTGGGGTTCTTATGTTCGAATA
GGTATTGCCATGGCCCACATGCACTCCTTTGCTGCCCTGAAGAAAGCTCTGTCTACCTGT
AGCTCCCACATTCTGGTTGTGCTGCTCCTTTTTGGCACTTTGGCTAGAATGTACCTTAAG
CCATCATCCAGCTATGACTTAGGCCAGGATCGCCAGGTTGCCATCTTCTACACGCTCATC
TCCCCTATGTTAAATCCACTAATTTACAGCCTTAGGAACCAAGATGTTAAAGGAGCACTA
TGGAGGCTTTTTAGGAAACTCCATACTTCAGACTGGCTCTCAGACAAAGAA


Conceptual translation

MATKNKTEVTEFVLLGLSSRPEIQPVIFGVVLIMYLMAVLGNTLLILVACSDPRLQTPMY
FLLSQLSLIDISLTTITIPQMLVHTLSVNRSISYNRCMTQLFFFMAVGSMEVYLLGAMAY
DRYVAICDPLRYSAIVSYSLCLQITLTSWMVVSLNSLLYSVLVTRLTFCGNKVTHFFCDI
TPLLKLSCTRPVLNEMLIFTEGVAVVGSPFFFIWGSYVRIGIAMAHMHSFAALKKALSTC
SSHILVVLLLFGTLARMYLKPSSSYDLGQDRQVAIFYTLISPMLNPLIYSLRNQDVKGAL
WRLFRKLHTSDWLSDKE