Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or12k8 Olfactory Receptor

Gene Symbol Or12k8
Organism Mouse
Family 12
Subfamily k
Pseudo No
Location chr2:37084781-37085746 (-)
Aliases Olfr361, RP23-29O14.1, MOR159-3

Sequence information


Nucleotide sequence

ATGGCTACTAAAAACAGGACAGAAGTGACTGAATTTGTGTTGTTGGGATTGTCCAGCCAG
CCAGAGATGCAGCCAGTTATTTTTGGAGTTGTCCTTATCATGTACCTGATGGCAGTTTTG
GGCAATACCCTACTAGTGCTTGTTGCTTGCTCAGACCCCAAGCTTCATACCCCCATGTAC
TTCCTTCTCAGTCAGCTTTCCTTGATTGACATATCTCTAACAACTATCATTGTTCCCCAG
ATGCTGGTGCACACACTTTCTGTAAACAGAACCATTTCCTATAACTGCTGCATGACACAG
CTCTTTTCCTTTATGACAGTGGGCAGTATGGAAGTTCACTTGCTTGGTGCAATGGCATAT
GACCGCTATGTTGCCATCTGTGACCCTTTAAGATATTCTTCCATTGTCAGCCATAGCCTC
TGTCTGCGAATAACATTGACCTCATGGGTGGTGGTCAGCCTTAACAGTCTCCTGTACAGT
GTGTTGGTCACTCGTTTAACCTTCTGTGGCAACAAGGTCACCCATTTCTTTTGTGACATC
ACTCCTCTACTGAAGCTCTCCTGTACTCGACCAGTGGTCAATGAAATGTTAATCTTCACT
GAGGGTGTAGCTGTGGTGGTAAGCCCCATTTTCTTTATTTTTGGCTCCTATGTTCGCATA
GGTATTGTTATAGCCCACATGCACTCAGTTGCTGCCCTGCAGAAAGCTCTGTCCACTTGT
AGCTCTCATGTTCTTGTTGTGATGTTTCTGTTTGGTTCTTTGGTTCACATGTACCTCAAG
CCATCATCCAGCTACAATCTAGAACAAGATCGCCAGGTTGCCATCTTTTACACACTCATT
TCTCCCATGTTAAATCCACTAATCTACAGCCTCAGGAACCAGGAAGTTAAAGGAGCTCTA
TGGAGGCTTTTTAGGAAACTATATCTCAGGCAGTGTCCAGCTTGGATTTCCCACAACACA
TGCCAG


Conceptual translation

MATKNRTEVTEFVLLGLSSQPEMQPVIFGVVLIMYLMAVLGNTLLVLVACSDPKLHTPMY
FLLSQLSLIDISLTTIIVPQMLVHTLSVNRTISYNCCMTQLFSFMTVGSMEVHLLGAMAY
DRYVAICDPLRYSSIVSHSLCLRITLTSWVVVSLNSLLYSVLVTRLTFCGNKVTHFFCDI
TPLLKLSCTRPVVNEMLIFTEGVAVVVSPIFFIFGSYVRIGIVIAHMHSVAALQKALSTC
SSHVLVVMFLFGSLVHMYLKPSSSYNLEQDRQVAIFYTLISPMLNPLIYSLRNQEVKGAL
WRLFRKLYLRQCPAWISHNTCQ