Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or13a17 Olfactory Receptor

Gene Symbol Or13a17
Organism Mouse
Family 13
Subfamily a
Pseudo No
Location chr7:140690907-140691839 (+)
Aliases Olfr45, IB6, MOR253-2

Sequence information


Nucleotide sequence

ATGATGTTGAGACTCAACCAGACAGAAGTAACAGAGTTTGTGCTGGAAGGGTTCTCAGAG
CACCCTGATCTAAGATTGTTCCTGATAGGCTGCTTCTTGACCCTCTACATAATGGCTCTG
ATGGGCAACATTTTGATCATCGCTTTGGTTACCTCCAGCACTGGGCTCCACAATCCCATG
TACTTTTTCCTGTGCAACCTGGCTACCACGGATATTTTGTGCACCTCCTCTGTGATTCCT
AAGGCCTTGGTTGGCCTAGTGTCTGAGGAAAACACTATCTCCTTCAAGGAATGTATGTCT
CAGCTCTTCTTCCTTGCATGGTCAGCATCTTCTGAGCTGCTGCTGCTCACGGTCATGGCC
TATGACCGCTATGTGGCCATCTGCTGTCCCCTGCACTACAGCTCTAGGATGAGCCCACAG
ATGTGTGGGGCCCTGGCCATGGGTGTATGGTCCATCAGTGCTGTGAATGCATCTGTGCAC
ACTGGCCTGATGACACGGCTGTCATTCTGTGGACCCAAGGTCATCACCCACTTCTTCTGT
GAGATTCCCCCACTCCTCCTGCTCTCCTGTAGTCCTACATATGTAAATACCATTATGACT
CTTTTGGGAGATTCCTTTTTTGGAGGCGTCAATTTTGTGCTTACCTTGCTATCCTATGGC
TGCATCATTGCCAGCATCCTGCGCATGCGTTCTGCTGAGGGCAAGAGGAAGGCCTTTTCT
ACCTGCTCATCCCACCTCATTGTGGTCTCTGTGTACTACTCATCTGTGTTCTGTGCCTAT
GTCAGCCCTGCTTCCAGCTACAGTCCAGAAAGAAGCAAAGTTACCTCAGTGTTATACTCG
ATCGTCAGCCCAACCCTCAACCCCCTCATCTATACACTGAGGAACAAGGATGTCAAGCTT
GCCTTGGGCAGAATATTGGCCTCTTTCTCACAT


Conceptual translation

MMLRLNQTEVTEFVLEGFSEHPDLRLFLIGCFLTLYIMALMGNILIIALVTSSTGLHNPM
YFFLCNLATTDILCTSSVIPKALVGLVSEENTISFKECMSQLFFLAWSASSELLLLTVMA
YDRYVAICCPLHYSSRMSPQMCGALAMGVWSISAVNASVHTGLMTRLSFCGPKVITHFFC
EIPPLLLLSCSPTYVNTIMTLLGDSFFGGVNFVLTLLSYGCIIASILRMRSAEGKRKAFS
TCSSHLIVVSVYYSSVFCAYVSPASSYSPERSKVTSVLYSIVSPTLNPLIYTLRNKDVKL
ALGRILASFSH