Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or13a18 Olfactory Receptor

Gene Symbol Or13a18
Organism Rat
Family 13
Subfamily a
Pseudo No
Location chr1:213169484-213170416 (+)
Aliases Olr305, Olr305

Sequence information


Nucleotide sequence

ATGGTCAGTCCTAACCAGTCAGTAGTGACAGAGTTTGTTCTGCAGGGGTTCTCAGAGCAC
CCTAGTCTAAAACTGTTTCTGACAGGCTGCTTCCTGTCTCTCTATACAATGGCTCTAATG
GGCAACATTGTGATCATTGCTTTGGTCACCTCCAGCACTGGACTCCACAGTCCCATGTAC
TTTTTCCTGTGCAACTTAGCAACCATGGACATTATCTGCACCTCCTCTGTTCTGCCCAAA
GCGCTGGTTGGTCTACTGTCTGAGGAAAACACCATCTCCTTCAAGGGATGCATGACCCAG
CTCTTCTTCCTTGTGTGGTCTGGATCCTCTGAGTTGCTGCTGCTCACAGTCATGGCCTAT
GACCGCTATGTAGCTATCTGCTGTCCCCTCCACTACAGCTCCAGGATGAGCCCACAACTG
TGTGGGGTAGTGGTCATTGGTGTATGGTCTGTCTGTGCACTGAATGCATCTATAAATACT
GGTCTGATGACACGGCTGTCATTCTGTGGGCCCAAGGTTATCACCCACTTCTTCTGTGAG
ATACCCCCACTCCTCCTGCTCTCCTGTAGCCCCACATATGTTAATAGCATTATGACTCTT
GCGTCAGATGCCTTTTATGGAGGTATCAACTTTGTGCTAACCCTGTTATCCTATGGTTGC
ATCATTGCCAGCATCCTGCGCATGCGTTCTGCTGAGGGCAAGAAGAAAGCCTTTTCTACC
TGCTCGTCCCACCTCATCGTGGTCGTTATGTATTATTCATCTGTGTTCTGTGCCTATATC
AGTCCTGCTTCCAGCTATAGCCCAGAAAGAAACAAATTTACCTCAGTGCTATACTCAATC
CTCAGCCCAACCCTAAACCCTCTCATCTATACACTGAGGAACAAGGATGTCAAGCATGCC
CTGGGCAGAATATTTGCCTCTTTCTCACATTAA


Conceptual translation

MVSPNQSVVTEFVLQGFSEHPSLKLFLTGCFLSLYTMALMGNIVIIALVTSSTGLHSPMY
FFLCNLATMDIICTSSVLPKALVGLLSEENTISFKGCMTQLFFLVWSGSSELLLLTVMAY
DRYVAICCPLHYSSRMSPQLCGVVVIGVWSVCALNASINTGLMTRLSFCGPKVITHFFCE
IPPLLLLSCSPTYVNSIMTLASDAFYGGINFVLTLLSYGCIIASILRMRSAEGKKKAFST
CSSHLIVVVMYYSSVFCAYISPASSYSPERNKFTSVLYSILSPTLNPLIYTLRNKDVKHA
LGRIFASFSH