Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or13a19 Olfactory Receptor

Gene Symbol Or13a19
Organism Mouse
Family 13
Subfamily a
Pseudo No
Location chr7:140322701-140323627 (+)
Aliases Olfr525, MOR251-2

Sequence information


Nucleotide sequence

ATGGAAATAAACAATTACACAACTGTGGTGGAGTTTGTCCTGCAGGGACTCTCTGAGGAC
CCTGGGCTCCAGGCTCTCTTCTTGGCCTTTTTCTTGCTTCTTTACATCCTGGCTCTTGCA
GGAAACACCCTCATCATCATAGCCATCAGCCTCAACTCAAGCCTTCACACCCCCATGTAC
TTCTTCCTTGCAAACCTGGCCCTGTTGGACATCGTCTGTACATCCACTGTTCTTCCCAAG
CTGCTGGAGGGTTTGGTGGGTAAGAGCAGCCACATTTCTTATAAGGGATGCATGACCCAA
CTCTTTTTCCTGACCTGGTTTCTAGGGGCTGAGCTGCTGCTGCTCACTGCCATGGCCTAT
GACCGCTATGTGGCCATCTGTCGCCCACTGCACTACAGCATGCTGATGAGCTGGCCCATC
TGTGTCCTGCTCGCCGGCAGTGTGTGGGTCATCAGTGCAGCCAGCACATCTGTGCACACT
GGCTTGATGGCACGACTCAATTTCTGTGGCCCCAACCAAATTCGTCACTTTTTATGTGAA
GTCCCAACACTGCTGCTTCTGTCTTGCAGCCCAACCACCCTCAACAACATCATGATTGTC
ATTGCAGATGTTTATTTTGGTGTGGTCAACTTTCTGTTGACTATGATATCCTATAGCTTC
ATCATCACCAGCATCCTGCGCATCCGCTCCACAGAGGGCAAGAAGCGAGCCTTCTCTACC
TGCTCTGCCCACCTGGTGGTGGTTGTCCTGTACTACTCCACCGTCATCTACACCTATTTG
CAGCCTGGCTCCGGATCCTCCTTGGAGAATGGCAAAGTAGTTGCTTTATTGTACACAGCA
GTCAGCCCTACCCTGAACCCCGCCATTTATTCTCTAAGGAACAAGGATGTCAAAGTTGCC
CTCAAAAAGTTATTTCCCTGTTTCCAA


Conceptual translation

MEINNYTTVVEFVLQGLSEDPGLQALFLAFFLLLYILALAGNTLIIIAISLNSSLHTPMY
FFLANLALLDIVCTSTVLPKLLEGLVGKSSHISYKGCMTQLFFLTWFLGAELLLLTAMAY
DRYVAICRPLHYSMLMSWPICVLLAGSVWVISAASTSVHTGLMARLNFCGPNQIRHFLCE
VPTLLLLSCSPTTLNNIMIVIADVYFGVVNFLLTMISYSFIITSILRIRSTEGKKRAFST
CSAHLVVVVLYYSTVIYTYLQPGSGSSLENGKVVALLYTAVSPTLNPAIYSLRNKDVKVA
LKKLFPCFQ