Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or13a20 Olfactory Receptor

Gene Symbol Or13a20
Organism Mouse
Family 13
Subfamily a
Pseudo No
Location chr7:140651981-140652916 (+)
Aliases Olfr53, IE12, MOR253-5

Sequence information


Nucleotide sequence

ATGATGTTGTTGAGTCTCAACCAGACAGGAGTGACAGAGTTTGTGCTGGAAGGGTTCTCA
GAGCATCCTGGTCTAAGACTGTTCCTGACAGGCTGCTTCTTGACCCTCTACATGATGGCT
CTAATGGGCAACATTGTGATCATTGCTTTGGTCACCTCCAGCACTGGACTCCACAATCCC
ATGTACTTTTTCCTGTGCAACCTGGCTACCACGGATATTGTGTGCACCTCCTCTGTGATT
CCTAAGGCCCTGATTGGCCTAGTATCTGAGGAAAACATCATCACCTTCAAGGGATGTATG
GCCCAGCTCTTCTTCCTTGCATGGGCAACATCCGCAGAGCTGTTGCTGCTCACGGTCATG
GCCTATGACCGCTATGTGGCTATCTGCTTTCCCCTACACTACAGCTCTAGGATGAGCCCA
CAGCTCTGTGGAGCACTGGCCGTGGGTGTATGGTCCATCAGTGCTGTGAATGCATCTGTG
CACACTGGCCTGATGACACGGCTGTCATTCTGTGGACCCAAGGTCATCACCCACTTCTTC
TGTGAGATACCCCCACTCCTCCTGCTCTCCTGTAGTTCCACATACATTAATAGTGTTATG
ACACTTGTGGCAGATGTCTTTCTGGGAGGCATCAACTTCATGTTAACCCTGTTATCTTAT
GGCTTCATCATTGCCAGCATCCTGCGCATGCGTTCTGCTGAGGGCAAGAGGAAGGCCTTT
TCTACCTGCTCATCCCACCTCATCGTGGTCTCAGTGTACTACTCATCTGTGTTCTGTGCC
TATATCAGTCCTGCTTCCAGCTACAGCCCAGAAAGAAGCAAATTTACCTCAGTGCTATAC
TCGGTCGTCAGTCCAACCCTCAACCCCCTCATCTATACACTGAGGAACAAGGATGTCAAG
CTTGCCTTGGGCAGGATGTTGGCCTCTTTCTCACAT


Conceptual translation

MMLLSLNQTGVTEFVLEGFSEHPGLRLFLTGCFLTLYMMALMGNIVIIALVTSSTGLHNP
MYFFLCNLATTDIVCTSSVIPKALIGLVSEENIITFKGCMAQLFFLAWATSAELLLLTVM
AYDRYVAICFPLHYSSRMSPQLCGALAVGVWSISAVNASVHTGLMTRLSFCGPKVITHFF
CEIPPLLLLSCSSTYINSVMTLVADVFLGGINFMLTLLSYGFIIASILRMRSAEGKRKAF
STCSSHLIVVSVYYSSVFCAYISPASSYSPERSKFTSVLYSVVSPTLNPLIYTLRNKDVK
LALGRMLASFSH