Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or13a21 Olfactory Receptor

Gene Symbol Or13a21
Organism Mouse
Family 13
Subfamily a
Pseudo No
Location chr7:140418845-140419771 (-)
Aliases Olfr532, MOR251-1

Sequence information


Nucleotide sequence

ATGGCAATAAACAATTCCACAACTGTGGTGGAGTTTGTCCTGCAGGGACTCTCTGAGGAC
CCTGGGCTCCAGGCTCTCTTCTTGGCCTTTTTCTTGCTCCTTTACATCCTGGCTCTTGCA
GGAAACACCCTCATCATCATAGCCATCAGCCTCAACCCAAGGCTTCACACACCCATGTAT
TTCTTCCTTGCAAACCTGGCCCTGTTGGACATCATCTGTACCTCCACTGTTGTTCCCAAG
CTGCTGGAGGGTTTGGTGGGTAAGAGCAGCCACATTTCTTATAAGGGATGCATGACCCAA
GTCTTCTTCCTCATCTGGGTTCTAGGGGCTGAGCTGCTGCTGCTCACTGCCATGGCCTAT
GACCGCTATGTGGCCATCTGCCGCCCACTGCACTACAACACACTGATGAGCTGGCCCATC
TGTGTCCTGCTTGCAGGTTTTGTGTGGGTGATTGGCATAGCCAACACATCTGTGCATATT
GGCCTGCTGGTGCGACTCAATTTCTGTGGCTCCAACCAAATTCGTCACTTCTTATGTGAA
GTCCCAACACTGCTGCTTCTGTCTTGCAGCCCAACCACCCTCAACAACATTATGCTTGTC
ATCGCAGATGTTTATTTTGGTGTGCTCAACTTTCTGTTGACTATGATATCCTACAGCTTC
ATCATTTCCAGCATCCTGCGCATTCGCTCAGCCGAGGGCAAGAAGCGTGCATTCTCTACC
TGCTCTGCCCACCTGGTAGTAGTCACCCTGTACTACTCCACCATCATCTACACCTATCTA
CAGCCTGGCTCTGGATCCTCCTTCCAGAATAGCAAGGTTGTTACCTTACTGTACACAGCA
GTCAGCCCTACCTTGAATCCCATCATTTATTCTCTAAGGAACAAGGATGTGAAGGTAGCC
CTCAAAAGGTTATTTCCCTGTTTTCAT


Conceptual translation

MAINNSTTVVEFVLQGLSEDPGLQALFLAFFLLLYILALAGNTLIIIAISLNPRLHTPMY
FFLANLALLDIICTSTVVPKLLEGLVGKSSHISYKGCMTQVFFLIWVLGAELLLLTAMAY
DRYVAICRPLHYNTLMSWPICVLLAGFVWVIGIANTSVHIGLLVRLNFCGSNQIRHFLCE
VPTLLLLSCSPTTLNNIMLVIADVYFGVLNFLLTMISYSFIISSILRIRSAEGKKRAFST
CSAHLVVVTLYYSTIIYTYLQPGSGSSFQNSKVVTLLYTAVSPTLNPIIYSLRNKDVKVA
LKRLFPCFH